[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07578.1
DDBJ      :             Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  698/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:230 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   62->164 3dhwA PDBj 2e-06 26.5 %
:RPS:PDB   122->163 3dhwA PDBj 4e-08 42.1 %
:RPS:SCOP  44->224 2r6gG1  f.58.1.1 * 5e-23 11.0 %
:RPS:PFM   98->166 PF00528 * BPD_transp_1 3e-04 31.9 %
:HMM:PFM   40->222 PF00528 * BPD_transp_1 3.7e-21 19.0 179/185  
:BLT:SWISS 44->222 GLNM_BACSU 9e-30 36.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07578.1 GT:GENE ABF07578.1 GT:PRODUCT Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 764038..764730 GB:FROM 764038 GB:TO 764730 GB:DIRECTION + GB:PRODUCT Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine GB:PROTEIN_ID ABF07578.1 GB:DB_XREF GI:93353489 InterPro:IPR000515 InterPro:IPR010065 LENGTH 230 SQ:AASEQ MLDVLQNYGLYFLIGQYPNGPLGGLALTVLLAASGLVLALPVGIVLGLCRVSPFRTLRWPATVLIYVVRGTPLLMVVFWAYFLLPSVTGHRTPQFATMLVALVVFDGAYLAEIVRAGIQGLPRGQMESARSLGLSYAQAMALVILPQALRNMLPSLVNQLVSTIKETSLGYIISLPEVSFIAGQISTQMLTQAAQVYLLLALSYFVMCFGLTRCAYLLERRLAARNAVKV GT:EXON 1|1-230:0| BL:SWS:NREP 1 BL:SWS:REP 44->222|GLNM_BACSU|9e-30|36.7|177/216| TM:NTM 6 TM:REGION 25->47| TM:REGION 63->85| TM:REGION 96->118| TM:REGION 129->151| TM:REGION 166->188| TM:REGION 198->219| SEG 20->43|gplgglaltvllaasglvlalpvg| BL:PDB:NREP 1 BL:PDB:REP 62->164|3dhwA|2e-06|26.5|98/203| RP:PDB:NREP 1 RP:PDB:REP 122->163|3dhwA|4e-08|42.1|38/203| RP:PFM:NREP 1 RP:PFM:REP 98->166|PF00528|3e-04|31.9|69/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 40->222|PF00528|3.7e-21|19.0|179/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 44->224|2r6gG1|5e-23|11.0|181/284|f.58.1.1| OP:NHOMO 4374 OP:NHOMOORG 732 OP:PATTERN 11--12----------1-1111114--21-2211----1122--2222--1-1----2------2--- ----4313333321411----6--1D------766636C914225283533-769135--2221577B5A4755576621421---------------------------11111111111111--------4---222441111-22342233322111-1--1--3322-2212--2212-1341111--26455555875566556623398556333754355555396222222222222222222246757AB885676666B93757D533388886665AA999888999986666566666666788BA988881354756454552323444233331221423319A-4122-1111111171--11136333322M68222422222375347567Q-22G22E28EK23pTTQUWTWVhMMPA---35L767935C1111111134511-48----------111111111111111--1-5--21-6IGCHKJJILHA8BBBCCHTBBBB8AEDZ77A412B9C94854B9HGNQ244----944422222---25-11K-997C56CAAA42-23-3----------6-4441666663242222222-13----78A-2-----C-1111--11111111-11-1---1--------9AJK6CC8888887887-88A8888888888788779HMFLK7757775777777777767F776777721EAAAAAA9AAAA--4-111111111--67F44452522212222166666-64554-FDEFHQKTAGICE5NJL----------777A999999988811---------------2----------------3413----------------------132-115111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2------6-----------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 98 STR:RPRED 42.6 SQ:SECSTR #############################################################HHHHHHHHHccHHHHHHHHHHHHHHTTcccccHHHH#HHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHH####HHHHHHHHHHHH################################################################## DISOP:02AL 227-231| PSIPRED cHHHHHccccEEEEEEcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //