[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07582.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->16 PF08916 * Phe_ZIP 0.00035 50.0 14/59  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07582.1 GT:GENE ABF07582.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(768492..768749) GB:FROM 768492 GB:TO 768749 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF07582.1 GB:DB_XREF GI:93353493 LENGTH 85 SQ:AASEQ MKQSWSDFCEKFAHAAENGHGEKTKPTLLSQTSVLSFTTLFLSAGGRIRQQVFVMAERVGFEPTVPSPVRLISSQVHSTTLPPLR GT:EXON 1|1-85:0| HM:PFM:NREP 1 HM:PFM:REP 3->16|PF08916|0.00035|50.0|14/59|Phe_ZIP| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,18-21,85-86| PSIPRED cccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccc //