[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07583.1
DDBJ      :             pilus assembly protein major pilin PilA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.24.1
:154 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  15->153 1oqwA_ d.24.1.1 * 3.9e-31 29.9 %
:HMM:PFM   43->151 PF00114 * Pilin 1.7e-15 29.8 104/108  
:HMM:PFM   13->32 PF07963 * N_methyl 3.1e-10 55.0 20/20  
:PROS 13->33|PS00409|PROKAR_NTER_METHYL
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07583.1 GT:GENE ABF07583.1 GT:PRODUCT pilus assembly protein major pilin PilA GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(769207..769671) GB:FROM 769207 GB:TO 769671 GB:DIRECTION - GB:PRODUCT pilus assembly protein major pilin PilA GB:PROTEIN_ID ABF07583.1 GB:DB_XREF GI:93353494 InterPro:IPR000983 InterPro:IPR001082 InterPro:IPR001120 InterPro:IPR002416 InterPro:IPR012902 LENGTH 154 SQ:AASEQ MKKARMGIRRVQKGFTLIELMIVVAIIGILAAIAIPAYQDYVAKSKAASAYADIAAGKTAYELMVVNPDNGTPTFTPAGIGLQIATGNCSAIAVAAPDNTGAATNAIQCTIAAPGRLGTAPVSIQFNRLATGLYTCTTTGITNTSFIPTGCVAG GT:EXON 1|1-154:0| PROS 13->33|PS00409|PROKAR_NTER_METHYL|PDOC00342| TM:NTM 1 TM:REGION 19->41| SEG 25->37|aiigilaaiaipa| SEG 40->56|dyvakskaasayadiaa| SEG 131->149|tglytctttgitntsfipt| HM:PFM:NREP 2 HM:PFM:REP 43->151|PF00114|1.7e-15|29.8|104/108|Pilin| HM:PFM:REP 13->32|PF07963|3.1e-10|55.0|20/20|N_methyl| HM:SCP:REP 15->153|1oqwA_|3.9e-31|29.9|134/144|d.24.1.1|1/1|Pili subunits| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-8| PSIPRED ccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccccccEEcccccccEEEccccccEEEEEEEccccccccEEEEEEEcccccccEEEEEEEEEEEEEEEEEEEcccccccEEccccccc //