[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07596.1
DDBJ      :             phosphoglycolate phosphatase
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  460/915 : Eukaryota  2/199 : Viruses  1/175   --->[See Alignment]
c.108.1
:218 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   73->216 2yy6A PDBj 2e-16 30.2 %
:RPS:PDB   4->214 3d6jA PDBj 1e-23 18.5 %
:RPS:SCOP  4->214 2hszA1  c.108.1.6 * 3e-37 24.3 %
:HMM:SCOP  4->217 1fezA_ c.108.1.3 * 3.9e-58 37.6 %
:RPS:PFM   84->180 PF00702 * Hydrolase 4e-06 26.8 %
:HMM:PFM   5->181 PF00702 * Hydrolase 1.7e-25 23.9 176/192  
:BLT:SWISS 33->214 GPH2_PSEAE 7e-42 42.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07596.1 GT:GENE ABF07596.1 GT:PRODUCT phosphoglycolate phosphatase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(785930..786586) GB:FROM 785930 GB:TO 786586 GB:DIRECTION - GB:PRODUCT phosphoglycolate phosphatase GB:PROTEIN_ID ABF07596.1 GB:DB_XREF GI:93353507 InterPro:IPR005834 InterPro:IPR006346 InterPro:IPR006402 InterPro:IPR006439 LENGTH 218 SQ:AASEQ MMTFDAVFFDLDGTLADTAPDLAAAANRLVIKHGMLPVAYERLRPVASHGARGLLGVAFGKRPEDPEFPALRDAFLDYYEADIAVHTRLFEGMDQVLAQLESTGIRWGIVTNKIARFTVPLVNAIGLTPRASAVVSGDTTPYAKPHPAPLLRAAELSGVAPGRCIYVGDDLRDIQAGQAAGMTTVAAAYGYCGEAEPPETWGADYLIRHPAELLPLFS GT:EXON 1|1-218:0| BL:SWS:NREP 1 BL:SWS:REP 33->214|GPH2_PSEAE|7e-42|42.3|182/226| SEG 10->26|dldgtladtapdlaaaa| BL:PDB:NREP 1 BL:PDB:REP 73->216|2yy6A|2e-16|30.2|139/206| RP:PDB:NREP 1 RP:PDB:REP 4->214|3d6jA|1e-23|18.5|205/206| RP:PFM:NREP 1 RP:PFM:REP 84->180|PF00702|4e-06|26.8|97/195|Hydrolase| HM:PFM:NREP 1 HM:PFM:REP 5->181|PF00702|1.7e-25|23.9|176/192|Hydrolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00702|IPR005834| GO:PFM GO:0008152|"GO:metabolic process"|PF00702|IPR005834| RP:SCP:NREP 1 RP:SCP:REP 4->214|2hszA1|3e-37|24.3|210/224|c.108.1.6| HM:SCP:REP 4->217|1fezA_|3.9e-58|37.6|213/256|c.108.1.3|1/1|HAD-like| OP:NHOMO 646 OP:NHOMOORG 468 OP:PATTERN ---------------------------------------------11---1-------11-------- 1-1---------------------------------------1-1----------1------------1-----------2211111----11--------------------------------111111--112--------1-----------------------------------------------1-11111112111111111--1-1111-111-1------12----------------------1--------11------1-----------------------------------------------------------------2----111-----11111--111-1---11------1-1111-----212121111111111111111111-111-2212111-11111111121111111211223212111111111111-1-2-------------------------------21111222222222222222222232222222233222-122432222232222222212112221222222211211---11-1-211--121-11111-1--1-------------------------11222222121111212223222232322222222--11222------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---111111----1122111111111111111122222222222122222223223222332-111111112-112111111111122222222221111212---------------1---------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3-1-------- --1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 218 STR:RPRED 100.0 SQ:SECSTR EcTccEEEEcccTTTEEcHHHHHHHHHHHHHHTTccccccHHHHTTTTccHHHHHHHHHccccHHHTcHHHHHHHHHHHHHHHGGGcEEcTTHHHHHHHHHHHTcEEEEEcccccHHHHHHHHHTccTTcccEEEcGGGccccTTcTHHHHHHHHHTTccGGGEEEEEccHHHHHHHHHHTcEEEEETTcccccTTGGGGccccEEEccGGGGcHHHc PSIPRED ccccEEEEEEccccccccccHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccEEEEEccccHHHHHHHHHHcccHHcccEEEEccccccccccHHHHHHHHHHccccHHHEEEEcccHHHHHHHHHcccEEEEEccccccccccHHHccccEEEccHHHHHHHHc //