[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07606.1
DDBJ      :             membrane protein-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  53/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->53 PF09834 * DUF2061 1e-09 52.9 %
:HMM:PFM   1->53 PF09834 * DUF2061 1.3e-24 50.9 53/53  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07606.1 GT:GENE ABF07606.1 GT:PRODUCT membrane protein-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(797912..798142) GB:FROM 797912 GB:TO 798142 GB:DIRECTION - GB:PRODUCT membrane protein-like protein GB:PROTEIN_ID ABF07606.1 GB:DB_XREF GI:93353517 LENGTH 76 SQ:AASEQ MAKTLTFGIMHLGIAFSVTYALTGSLAISGAITFIEPAVNTVAHYFFDKFWERRERQAKTLAAPPEATTAARYAAA GT:EXON 1|1-76:0| TM:NTM 1 TM:REGION 9->31| SEG 58->75|aktlaappeattaaryaa| RP:PFM:NREP 1 RP:PFM:REP 3->53|PF09834|1e-09|52.9|51/53|DUF2061| HM:PFM:NREP 1 HM:PFM:REP 1->53|PF09834|1.3e-24|50.9|53/53|DUF2061| OP:NHOMO 56 OP:NHOMOORG 53 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------1111------1---------------1----1-1-------------------------------------------------------------------11--11-11-1111111-1111-1111-11--------------------------------------------------------------------------------------------------------------11-1-------------------------1-2112----2----1----------------11111111111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,70-71,75-77| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcc //