[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07623.1
DDBJ      :             electron transfer flavoprotein beta-subunit
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  534/915 : Eukaryota  170/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:267 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->260 1efpB PDBj 3e-81 64.5 %
:RPS:PDB   19->266 2a1uB PDBj 4e-70 63.7 %
:RPS:SCOP  19->260 1efpB  c.26.2.3 * 1e-61 67.4 %
:HMM:SCOP  19->260 1efpB_ c.26.2.3 * 2.4e-97 55.2 %
:RPS:PFM   50->193 PF01012 * ETF 3e-22 52.5 %
:HMM:PFM   50->201 PF01012 * ETF 7.8e-42 41.9 148/164  
:BLT:SWISS 19->267 ETFB_PSEAE 2e-98 73.1 %
:PROS 173->193|PS01065|ETF_BETA

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07623.1 GT:GENE ABF07623.1 GT:PRODUCT electron transfer flavoprotein beta-subunit GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 814797..815600 GB:FROM 814797 GB:TO 815600 GB:DIRECTION + GB:PRODUCT electron transfer flavoprotein beta-subunit GB:PROTEIN_ID ABF07623.1 GB:DB_XREF GI:93353534 InterPro:IPR000049 LENGTH 267 SQ:AASEQ MASDSKKFWTISYQWSERMKVLVAVKRVVDYNVKVRVKSDGTGVDLANVKMSMNPFDEIAVEEAVRLKEAGVVTEVIAVSCGVAQCQETLRTAMAIGADRGILVESNEDLQPLAVAKLLKALIDKEQPQLVILGKQAIDDDSNQTGQMVAALAGMPQATFASKVVLADGKASVTREVDGGLETVSIKLPAVVTTDLRLNEPRYVTLPNIMKAKKKPLETVKPEDLGVDVKPRLSTVKVVEPAKRSAGVMVPDVATLVQKLKTEAKVI GT:EXON 1|1-267:0| BL:SWS:NREP 1 BL:SWS:REP 19->267|ETFB_PSEAE|2e-98|73.1|249/249| PROS 173->193|PS01065|ETF_BETA|PDOC00816| BL:PDB:NREP 1 BL:PDB:REP 19->260|1efpB|3e-81|64.5|242/246| RP:PDB:NREP 1 RP:PDB:REP 19->266|2a1uB|4e-70|63.7|248/252| RP:PFM:NREP 1 RP:PFM:REP 50->193|PF01012|3e-22|52.5|139/157|ETF| HM:PFM:NREP 1 HM:PFM:REP 50->201|PF01012|7.8e-42|41.9|148/164|ETF| RP:SCP:NREP 1 RP:SCP:REP 19->260|1efpB|1e-61|67.4|242/246|c.26.2.3| HM:SCP:REP 19->260|1efpB_|2.4e-97|55.2|239/246|c.26.2.3|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 1060 OP:NHOMOORG 734 OP:PATTERN 22----2222222222-11311211111-111-----------------------------3322--- 1232111111111111111-1111111111111111111211111--11---111-12--112-1111121---------11------11111122---111111111-1---------------1111111112111122---12-------11-----------1----------------11111--11211111111111111111111111111131111------21----------------------1-------------------------------------------------------------------1532444444443431422422214-1-1-12-553463-141--1--2-12-111111111322221112222211111111111-1121131112113112334335132311111111111112222222212211322-----------------------------1121112311211122211111113611111134511121112161222231212111-112111111111---14115421----------7471926--11211114-------------------------1111-1111121-1111111311112132121-----1-------1---1--2221212121-2222222222212112111--------2121222221212112--112221-----------------1111111111-1113---------------11111111114111111111111111112-------------1-----11-1111111111111111--11111111----------1-------------------------11111121111-- ----111-211-111-11111111111111111111111111111111111111-1111111111111-11111111111111111-1-12111111111111112-1312111121-1--11111131282-112-11-11111-11111--1--1111111111121121121111-----111112-111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 260 STR:RPRED 97.4 SQ:SECSTR #######EEEEEHHHHHHcEEEEEccEEEcTTccccccTTccccccTTccEEEcHHHHHHHHHHHHHHHTTcccEEEEEEEEcTTHHHHHHHHHHHTccEEEEEEccHHccHHHHHHHHHHHHHHTTccEEEEEcccTTTccccHHHHHHHHHTccEEEEEEEEEEcccEEEEEEEETTEEEEEEEEccEEEEEcTTccccccccHHHHHHHTTccEEEEcGGGGTccccccccccccccccccccccccccHHHHHHHHHHTTccH DISOP:02AL 1-5,238-248| PSIPRED cccccccEEEEEEcccccEEEEEEEEEcccccccEEEEcccccEEEccccccccHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHcccEEEEEEEEEEEccEEEEEEEEcccEEEEEEcccEEEEEcccccccccccHHHHHHHccccEEEEcHHHccccccccEEEEEEEccccccccEEcccHHHHHHHHHHHcccc //