[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07632.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:137 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   56->132 PF07172 * GRP 0.001 18.5 65/95  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07632.1 GT:GENE ABF07632.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(823621..824034) GB:FROM 823621 GB:TO 824034 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF07632.1 GB:DB_XREF GI:93353543 LENGTH 137 SQ:AASEQ MFTRPLLRLMVAGSVAVAGLGGSIAVSHAQVAFWHHSRTDRTVQAVHAANGWEIASVRAENRDHVQAQIDRMEARARNDDRLSGRPASPGGRDDEQRARQPGGGDRNSPGEATLRNSEAHPGNVGPGWQARGRDGGR GT:EXON 1|1-137:0| TM:NTM 1 TM:REGION 9->31| SEG 11->27|vagsvavaglggsiavs| HM:PFM:NREP 1 HM:PFM:REP 56->132|PF07172|0.001|18.5|65/95|GRP| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,76-122,131-138| PSIPRED ccHHHHHHHHHHccHHEEcccccEEEEEEEEEEEccccccccccEEEccccEEEEEEEcccHHHHHHHHHHHHHHHHccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccc //