[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07658.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  60/915 : Eukaryota  18/199 : Viruses  1/175   --->[See Alignment]
a.211.1
:179 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  13->129 2o6iA1  a.211.1.1 * 4e-05 15.4 %
:HMM:PFM   31->87 PF01966 * HD 6.5e-08 33.3 54/118  
:BLT:SWISS 6->171 YL432_MIMIV 1e-17 32.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07658.1 GT:GENE ABF07658.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(848436..848975) GB:FROM 848436 GB:TO 848975 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF07658.1 GB:DB_XREF GI:93353569 LENGTH 179 SQ:AASEQ MTTLTLSSIAALFENHGTAYYGGEAISQTAHALQCALLAEQAGDPEPLIVAALLHDIGHLMLAESLTTDMRHQETGADALASLFGEDVTEPVRMHVAAKRYLCAVDPAYFDTLSPVSVHSLSLQGGPYDGEQASVFAAQAHADAAVRLRRYDDLAKVVDLQTPTLSHYLDMAARCVRVA GT:EXON 1|1-179:0| BL:SWS:NREP 1 BL:SWS:REP 6->171|YL432_MIMIV|1e-17|32.5|166/219| SEG 133->145|asvfaaqahadaa| HM:PFM:NREP 1 HM:PFM:REP 31->87|PF01966|6.5e-08|33.3|54/118|HD| RP:SCP:NREP 1 RP:SCP:REP 13->129|2o6iA1|4e-05|15.4|117/436|a.211.1.1| OP:NHOMO 86 OP:NHOMOORG 79 OP:PATTERN -------------------------------------------------------------------- ----1---------------------------1-1-------1-----------------11-------------------------------------------1--------------------------------------------------------------1--------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------11---------------------------------------------------1111-11111111-1111111111-1111-111--11--------1-12-------1-----------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------11111111--1------------------------------------------------------------------------------------------------------- ------1--------12------11------------------------1-1-1--------------------------------------2----------11--13-2--------------------------------------------------1--1--------2--------------1---------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- DISOP:02AL 1-1,179-180| PSIPRED cccEEHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHc //