[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07685.1
DDBJ      :             binding-protein-dependent transport systems inner membrane component
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  516/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:238 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   104->172 3dhwA PDBj 3e-06 34.8 %
:RPS:PDB   130->170 3dhwA PDBj 3e-11 36.6 %
:RPS:SCOP  46->203 2r6gG1  f.58.1.1 * 2e-14 18.4 %
:HMM:PFM   60->233 PF00528 * BPD_transp_1 6.3e-22 27.7 173/185  
:HMM:PFM   4->38 PF05106 * Phage_holin_3 0.00019 28.6 35/100  
:BLT:SWISS 34->197 YEHW_ECOLI 2e-24 45.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07685.1 GT:GENE ABF07685.1 GT:PRODUCT binding-protein-dependent transport systems inner membrane component GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 875618..876334 GB:FROM 875618 GB:TO 876334 GB:DIRECTION + GB:PRODUCT binding-protein-dependent transport systems inner membrane component GB:PROTEIN_ID ABF07685.1 GB:DB_XREF GI:93353596 InterPro:IPR000515 LENGTH 238 SQ:AASEQ MSKQTIRAFAWSGVVAVALAGLVAWIGVDVISQYQERLFYDVADHLRLVAISMALALATGIPAGIGLSRPCMHRWADRLMQIFNVGNTVPSLAVLALALAVLGIGERPAILALWLASLLPIVRNTYEGLRNVSPALLEAARGIGMTPCQQLIRVELPNALPVILAGVRISLVINVGTVPLSFLIGANSLGELIFPGIYLNNQSLLLLGAGATALLALTLDALFATAGHVYLRRRGLAR GT:EXON 1|1-238:0| BL:SWS:NREP 1 BL:SWS:REP 34->197|YEHW_ECOLI|2e-24|45.1|164/243| TM:NTM 4 TM:REGION 8->30| TM:REGION 47->69| TM:REGION 84->106| TM:REGION 109->131| SEG 13->24|gvvavalaglva| SEG 92->102|lavlalalavl| SEG 204->227|llllgagatallaltldalfatag| BL:PDB:NREP 1 BL:PDB:REP 104->172|3dhwA|3e-06|34.8|69/203| RP:PDB:NREP 1 RP:PDB:REP 130->170|3dhwA|3e-11|36.6|41/203| HM:PFM:NREP 2 HM:PFM:REP 60->233|PF00528|6.3e-22|27.7|173/185|BPD_transp_1| HM:PFM:REP 4->38|PF05106|0.00019|28.6|35/100|Phage_holin_3| RP:SCP:NREP 1 RP:SCP:REP 46->203|2r6gG1|2e-14|18.4|158/284|f.58.1.1| OP:NHOMO 1348 OP:NHOMOORG 535 OP:PATTERN -----------------------2--------2--1--111111211--3113-------2------- 1-1-311---1-3-211----4--24-----223335465-3-12-11-111412223--22--3245541---------1-4-----1111-2-----------1-11------------------------------12---2-211111122--1---1----21111-1-----1----212-----1-52222222212222225-3345222111242144444425322222222222222344233-31341-1-13311444-312-222444221214411111111111222222222222221111-1112-113111111111111333111112---2----2211-123-31----11---2--1------223311-1112155555554554-222222-42511C6645478478722--1-1722112-2111111111---1--3-----------------------------11-2--133212555544444233124444246334443--223--111113246-------4---------------22113111-2112----------1-1122-----------------------------11----1---3-1111-11------1--11---11--------6622-624444444444-4444444434444444446454221114434444444444444433343441-244444424444----11111------451----11-----------------11315555767645656-766-----------111-----12311--21111111----------------------------------------------------2---------- -------------1-----------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 69 STR:RPRED 29.0 SQ:SECSTR #######################################################################################################ccHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHH################################################################## DISOP:02AL 1-4,238-239| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //