[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07694.1
DDBJ      :             4-oxalocrotonate tautomerase family enzyme
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.80.1
:62 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->60 2op8A PDBj 2e-08 39.0 %
:RPS:PDB   2->60 3ej7C PDBj 2e-14 30.5 %
:RPS:SCOP  2->62 1bjpA  d.80.1.1 * 1e-14 29.5 %
:HMM:SCOP  2->62 1gyxA_ d.80.1.1 * 1.6e-15 37.7 %
:RPS:PFM   2->56 PF01361 * Tautomerase 2e-08 40.0 %
:HMM:PFM   5->59 PF01361 * Tautomerase 8.3e-17 38.2 55/60  
:BLT:SWISS 1->62 Y807_RALSO 2e-27 79.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07694.1 GT:GENE ABF07694.1 GT:PRODUCT 4-oxalocrotonate tautomerase family enzyme GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 884498..884686 GB:FROM 884498 GB:TO 884686 GB:DIRECTION + GB:PRODUCT 4-oxalocrotonate tautomerase family enzyme GB:PROTEIN_ID ABF07694.1 GB:DB_XREF GI:93353605 InterPro:IPR004370 LENGTH 62 SQ:AASEQ MPTFHVEMFEGRTVEQKRKFVEEVTRVTCETLGCSSGAVDIIITDVKRENWATGGELWADKK GT:EXON 1|1-62:0| BL:SWS:NREP 1 BL:SWS:REP 1->62|Y807_RALSO|2e-27|79.0|62/62| BL:PDB:NREP 1 BL:PDB:REP 2->60|2op8A|2e-08|39.0|59/61| RP:PDB:NREP 1 RP:PDB:REP 2->60|3ej7C|2e-14|30.5|59/59| RP:PFM:NREP 1 RP:PFM:REP 2->56|PF01361|2e-08|40.0|55/59|Tautomerase| HM:PFM:NREP 1 HM:PFM:REP 5->59|PF01361|8.3e-17|38.2|55/60|Tautomerase| GO:PFM:NREP 2 GO:PFM GO:0006725|"GO:cellular aromatic compound metabolic process"|PF01361|IPR004370| GO:PFM GO:0016853|"GO:isomerase activity"|PF01361|IPR004370| RP:SCP:NREP 1 RP:SCP:REP 2->62|1bjpA|1e-14|29.5|61/62|d.80.1.1| HM:SCP:REP 2->62|1gyxA_|1.6e-15|37.7|61/0|d.80.1.1|1/1|Tautomerase/MIF| OP:NHOMO 40 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------1---11-1-1---------------------------------------------------------------------111-111111-----1111-----11--1111--111--1111111-111--------------------------1---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 62 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEETTccHHHHHHHHHHHHHHHHHHHcccGGGcEEEEEEEcGGGcEETTEEcccHc DISOP:02AL 60-63| PSIPRED ccEEEEEEEccccHHHHHHHHHHHHHHHHHHHcccHHHEEEEEEEEccccEEEccEEEcccc //