[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07698.1
DDBJ      :             peptidylprolyl isomerase, FKBP-type
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  488/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
d.26.1
:115 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->115 2ke0A PDBj 2e-45 77.1 %
:RPS:PDB   3->113 3chxA PDBj 6e-36 8.1 %
:RPS:SCOP  1->115 1fd9A  d.26.1.1 * 9e-32 40.4 %
:HMM:SCOP  3->116 1q6hA_ d.26.1.1 * 2.7e-41 57.0 %
:RPS:PFM   22->113 PF00254 * FKBP_C 3e-20 58.0 %
:HMM:PFM   16->113 PF00254 * FKBP_C 1.9e-36 60.6 94/96  
:BLT:SWISS 7->115 FKBP_NEIMB 5e-35 64.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07698.1 GT:GENE ABF07698.1 GT:PRODUCT peptidylprolyl isomerase, FKBP-type GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(886734..887081) GB:FROM 886734 GB:TO 887081 GB:DIRECTION - GB:PRODUCT peptidylprolyl isomerase, FKBP-type GB:PROTEIN_ID ABF07698.1 GB:DB_XREF GI:93353609 InterPro:IPR001179 LENGTH 115 SQ:AASEQ MQTTPSGLQFEDTVVGSGDEAKAGKHVTVHYTGWLFENGQAGRKFDSSKDRNDPFVFPLGAGHVIRGWDEGVQGMKVGGTRRLVIPADLGYGARGAGGVIPPNATLLFEVELLAV GT:EXON 1|1-115:0| BL:SWS:NREP 1 BL:SWS:REP 7->115|FKBP_NEIMB|5e-35|64.8|105/109| BL:PDB:NREP 1 BL:PDB:REP 3->115|2ke0A|2e-45|77.1|109/117| RP:PDB:NREP 1 RP:PDB:REP 3->113|3chxA|6e-36|8.1|111/362| RP:PFM:NREP 1 RP:PFM:REP 22->113|PF00254|3e-20|58.0|88/91|FKBP_C| HM:PFM:NREP 1 HM:PFM:REP 16->113|PF00254|1.9e-36|60.6|94/96|FKBP_C| GO:PFM:NREP 1 GO:PFM GO:0006457|"GO:protein folding"|PF00254|IPR001179| RP:SCP:NREP 1 RP:SCP:REP 1->115|1fd9A|9e-32|40.4|109/204|d.26.1.1| HM:SCP:REP 3->116|1q6hA_|2.7e-41|57.0|107/210|d.26.1.1|1/1|FKBP-like| OP:NHOMO 2447 OP:NHOMOORG 686 OP:PATTERN ----------------------------------------------1--------------------- -12-21111111111------1--11-----1111121111212222221-22222221122212-122322222222111-------33331333---124332253-1111111111111111---11------11111---2-1211221111111111111111111111111111111111----2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-32221------111111-11111------------111111111------1----------111-------------------111--1------------------------------1-12-1-----1111112----11221111-11122222-12222222222212-11111213211222221111122-3221---------52223233-222243-----------------------1-----332212313335455444555554554566--11--2-1-11122222222222222222-2222222222222222222222222222222222222222222211221212-222222212222--121111111111111221222211111222233333231113344344434444443444---------23333333333333322222222221111111-221111---1-11111---------------------------1--------14- 1111574194454564445544454421243332223444344323333333332333434432323313442334433433332233-35343543233333555-6r8CGOEDHA75779C6IG4J8b*F1GCK5878J5CED7A857C65D8DBCC77868974658768865EBD*A8869EFKN5HFEF9CAAW ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 100.0 SQ:SECSTR EccccccccccccccEEEcccccEEEEccccccccccccccTTccccccTTccTTccccccccccTTccccccEEEEccHHHHTTcGGGGccccccccEEEEcccccccEEEEEE PSIPRED cEEcccccEEEEEEcccccccccccEEEEEEEEEEEccccccEEEccccccccEEEEEEccccccHHHHHHHcccccccEEEEEEcHHHccccccccccccccccEEEEEEEEEc //