[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07712.1
DDBJ      :             protein of unknown function DUF1468
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->145 PF07331 * DUF1468 9e-14 34.3 %
:HMM:PFM   4->148 PF07331 * DUF1468 5.9e-52 48.3 143/144  
:BLT:SWISS 29->150 YTZ1_AGRVI 2e-05 25.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07712.1 GT:GENE ABF07712.1 GT:PRODUCT protein of unknown function DUF1468 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(900237..900698) GB:FROM 900237 GB:TO 900698 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF1468 GB:PROTEIN_ID ABF07712.1 GB:DB_XREF GI:93353623 InterPro:IPR009936 LENGTH 153 SQ:AASEQ MRIRSQKDFASGLMFILVGLGFSFVARGYSMGTAAKMGPGYFPFWLGIVLALLGALVLWGSLSSKAAQDSLERWDIKILLWILGAVVLFGLLLKPLGMVLSVVVLVLVSSMASHEFSWKGAVLNAIILVLISMGAFVYGINLQMPVWPAFLAS GT:EXON 1|1-153:0| BL:SWS:NREP 1 BL:SWS:REP 29->150|YTZ1_AGRVI|2e-05|25.0|120/100| TM:NTM 4 TM:REGION 9->31| TM:REGION 44->66| TM:REGION 82->104| TM:REGION 119->141| SEG 45->64|wlgivlallgalvlwgslss| SEG 99->110|vlsvvvlvlvss| RP:PFM:NREP 1 RP:PFM:REP 4->145|PF07331|9e-14|34.3|140/142|DUF1468| HM:PFM:NREP 1 HM:PFM:REP 4->148|PF07331|5.9e-52|48.3|143/144|DUF1468| OP:NHOMO 36 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------1--1----------------------------------------------------------------------11112------------------------2222111111111111112111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccEEcHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcc //