[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07721.1
DDBJ      :             Uncharacterized protein UPF0065
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  228/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.288.1c.94.1e.26.1
:351 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   55->345 2qpqA PDBj 2e-56 36.9 %
:RPS:PDB   54->351 2dvzA PDBj 3e-70 39.5 %
:RPS:SCOP  54->112 1jqkA  e.26.1.2 * 6e-14 16.9 %
:RPS:SCOP  260->351 2o70A1  a.288.1.1 * 2e-22 9.8 %
:HMM:SCOP  140->314 1hslA_ c.94.1.1 * 1.9e-14 31.3 %
:RPS:PFM   74->345 PF03401 * Bug 8e-67 50.6 %
:HMM:PFM   74->345 PF03401 * Bug 3.7e-102 48.7 271/274  
:HMM:PFM   33->61 PF12324 * HTH_15 0.0004 38.5 26/77  
:BLT:SWISS 54->350 YTCB_PSESQ 3e-60 38.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07721.1 GT:GENE ABF07721.1 GT:PRODUCT Uncharacterized protein UPF0065 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 912828..913883 GB:FROM 912828 GB:TO 913883 GB:DIRECTION + GB:PRODUCT Uncharacterized protein UPF0065 GB:PROTEIN_ID ABF07721.1 GB:DB_XREF GI:93353632 InterPro:IPR005064 LENGTH 351 SQ:AASEQ MFQTLSPIAAQGGTRRVSHLSTLLRRCLGVAIALAAGATVSTTALANTTGTTAWPQKAVTVVVPFPAGGSTDTIARMLAAPLNEKLGQPFVIDNRPGATGAIGATFVKRAPADGYTMMVASIGVYAVNPFLQKNLQYDPAKDFDLLTVAVRAPNVLVANPNFPAKTLQELVAYMKKNPGKVSFATSGAGSSDHLTAALFWQKSGTDGLHVPYKGGAPAISDLLAGQVDVSFQNINAVLQHIRSGKLRALAVTSDKRSAVLPNVPTMAEGGVKDVEVYSWQGVAAPKGLPADVKSRLHGAIVTALKDAKMQQKLNEQGFEVVGNSPEQFAEFETQELKRWKTVIEQGKITAE GT:EXON 1|1-351:0| BL:SWS:NREP 1 BL:SWS:REP 54->350|YTCB_PSESQ|3e-60|38.9|296/336| SEG 38->53|atvsttalanttgtta| BL:PDB:NREP 1 BL:PDB:REP 55->345|2qpqA|2e-56|36.9|290/296| RP:PDB:NREP 1 RP:PDB:REP 54->351|2dvzA|3e-70|39.5|291/292| RP:PFM:NREP 1 RP:PFM:REP 74->345|PF03401|8e-67|50.6|271/274|Bug| HM:PFM:NREP 2 HM:PFM:REP 74->345|PF03401|3.7e-102|48.7|271/274|Bug| HM:PFM:REP 33->61|PF12324|0.0004|38.5|26/77|HTH_15| GO:PFM:NREP 1 GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03401|IPR005064| RP:SCP:NREP 2 RP:SCP:REP 54->112|1jqkA|6e-14|16.9|59/610|e.26.1.2| RP:SCP:REP 260->351|2o70A1|2e-22|9.8|92/165|a.288.1.1| HM:SCP:REP 140->314|1hslA_|1.9e-14|31.3|150/238|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 2351 OP:NHOMOORG 233 OP:PATTERN -------------------------------------------------------------------- --------111----------1---1------1222-1-1----1-------132-1-------212-111-----------2-----------------------------------------------------111--------------------------------------------41---11---11111111--1111115122-1111--114--------3--------------------------------------------------------------------------------------------5---------------------1----1----55-----1-------1---------------Y67--874986----------3-21111---G---14423386336562---6353-35425--------------1------------------------------1-----R****-------------1---------D****9G322K7tkj*f*3**5A1-----------------1----12-1-1----1----------1111----1--------------------------11--1-----1-1111----11---------------------1111------1-111-------111-1--1-11-113-----11111111111111-1-111------------------------------------386---1-2--------1--------1-4-11-111--2111111-1----------1-111111111112--1--------------1------------------------------------------------4------ -------------1------------------------------------------------------------------------------------------------------------------------------------------------M--------------1-----------1--s---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 298 STR:RPRED 84.9 SQ:SECSTR #####################################################cccccEEEEEcccTTcHHHHHHHHHHHHHHHHTTTccEEEEcccGGGHHHHHHHHHccTTccEEEEEcHHHHHHHHHcTTTccccTTTcEEEEEEEEEEcEEEEEcTTcccccHHHHHHHHHTcTTTcEEEEccTTcHHHHHHHHccHHHTcccEEEEcccHHHHHHHHHHTcccEEEEEHGHHHHHHHTTccEEEEEEcccccGGGTTcccTTTTTcGGGcccEEEEEEEETTccHHHHHHHHHHHHHHHTcHHHHHHHHHHTEEEccccHHHHHHHHHHHHHHHHHHHHcTTcccc DISOP:02AL 1-1,4-5,351-352| PSIPRED ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEccccccHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHcccccccEEEEEccHHHHHHHHHcccccccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHccccEEEEccccHHHHHHHHHcccccEEEEcHHHHHHHHHcccEEEEEEEcccccccccccccHHHcccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHccHHHHHHHHHcccEEccccHHHHHHHHHHHHHHHHHHHHHcccccc //