[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07726.1
DDBJ      :             transcriptional regulator, IclR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  168/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.110.2
:271 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->143 1mkmB PDBj 9e-07 25.9 %
:RPS:PDB   38->153 2cweA PDBj 3e-08 11.2 %
:RPS:SCOP  29->103 1mkmA1  a.4.5.33 * 4e-13 26.0 %
:RPS:SCOP  106->262 1mkmA2  d.110.2.2 * 3e-10 12.8 %
:HMM:SCOP  28->104 1mkmA1 a.4.5.33 * 9.8e-16 42.7 %
:HMM:SCOP  94->267 1tf1A_ d.110.2.2 * 1.2e-25 31.2 %
:HMM:PFM   30->81 PF09339 * HTH_IclR 1e-16 37.3 51/52  
:HMM:PFM   155->258 PF01614 * IclR 1.7e-05 28.2 103/129  
:BLT:SWISS 29->153 KIPR_BACSU 6e-11 27.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07726.1 GT:GENE ABF07726.1 GT:PRODUCT transcriptional regulator, IclR family GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(919278..920093) GB:FROM 919278 GB:TO 920093 GB:DIRECTION - GB:PRODUCT transcriptional regulator, IclR family GB:PROTEIN_ID ABF07726.1 GB:DB_XREF GI:93353637 InterPro:IPR005471 LENGTH 271 SQ:AASEQ MDTKKTRSTSEGETEMRDEAVGRKTAGAQTLRRGLEILRLLARHQEEGATLADIVTESGLERPTAYRLLCSLEEERFVERNIHSKRYRLGIDAMQLGAAAAEKAPIVDLVAPLMKKLARVSGDTVFLVVPQGDFTVCLHREEGPFPVRVFTTVPGQRRLLGIGAGGLALMSAMSDDAIREVHKRKHALYAEAGMPISRLLAAAARSRRKGYAEIVDTITEGVSGVGCAFQLPFGASAAISFGAISSRMNASRRDELGALMVRELSTMNPAG GT:EXON 1|1-271:0| BL:SWS:NREP 1 BL:SWS:REP 29->153|KIPR_BACSU|6e-11|27.0|122/250| SEG 159->169|llgigagglal| SEG 197->208|srllaaaarsrr| SEG 233->246|fgasaaisfgaiss| BL:PDB:NREP 1 BL:PDB:REP 30->143|1mkmB|9e-07|25.9|112/247| RP:PDB:NREP 1 RP:PDB:REP 38->153|2cweA|3e-08|11.2|116/191| HM:PFM:NREP 2 HM:PFM:REP 30->81|PF09339|1e-16|37.3|51/52|HTH_IclR| HM:PFM:REP 155->258|PF01614|1.7e-05|28.2|103/129|IclR| RP:SCP:NREP 2 RP:SCP:REP 29->103|1mkmA1|4e-13|26.0|73/75|a.4.5.33| RP:SCP:REP 106->262|1mkmA2|3e-10|12.8|156/171|d.110.2.2| HM:SCP:REP 28->104|1mkmA1|9.8e-16|42.7|75/0|a.4.5.33|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 94->267|1tf1A_|1.2e-25|31.2|173/0|d.110.2.2|1/1|GAF domain-like| OP:NHOMO 277 OP:NHOMOORG 169 OP:PATTERN -------------------------------------------------------------------- --1-----------1------1----------1----1542--1-21-----222---------1--11--1---111----2-----------------------------------------------------------------------------------------------------1111---1--222222222222222122211221--121--------2--------------------------------------------------------------------------------------------1-----------------1-------------11------1----1---------------2-331--1-1---1111111-112---1--2-122---112--2--222421--1-1--111--------------------------------------------------2--277361112-1-111-11211112--1112743--221212114-213511-----------------2----1----------------12------------------------------------------------------------------------1------------------1-111-------1-1-1--1-11-111----------------------------------------------------------------111------------------------------11--1---222------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 222 STR:RPRED 81.9 SQ:SECSTR ##cccccccTTHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEEEEETTEEEEEEEEcccEEEEcTTcccHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHTcccEEGGcHHHHHTTcHHHHHHHHHHH####HHHHGGGTcccccHHHHHHHHHHHcEEEEEccccTTEEEEEEE########################################### DISOP:02AL 1-30,271-272| PSIPRED cccHHHccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEccccccEEEcHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccEEEEEEEccEEEEEEEEEccccEEEEEEEccEEEEEEEcHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccEEEEccccccccEEEEEcccccccccccEEHHHHHHcccHHHHHHHHHHHHHHHHHHHccc //