[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07739.1
DDBJ      :             protein serine/threonine phosphatases
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  389/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.219.1
:304 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->205 2j86A PDBj 2e-22 36.8 %
:RPS:PDB   2->280 1a6qA PDBj 9e-25 14.7 %
:RPS:SCOP  1->244 1txoA  d.219.1.1 * 1e-31 28.4 %
:HMM:SCOP  1->245 1txoA_ d.219.1.1 * 7.9e-49 35.1 %
:RPS:PFM   28->229 PF00481 * PP2C 8e-07 30.9 %
:HMM:PFM   34->138 PF00481 * PP2C 1.5e-12 24.5 102/257  
:HMM:PFM   181->241 PF07228 * SpoIIE 0.00083 27.9 61/193  
:BLT:SWISS 14->237 PRPC_BACSU 8e-21 31.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07739.1 GT:GENE ABF07739.1 GT:PRODUCT protein serine/threonine phosphatases GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(933474..934388) GB:FROM 933474 GB:TO 934388 GB:DIRECTION - GB:PRODUCT protein serine/threonine phosphatases GB:PROTEIN_ID ABF07739.1 GB:DB_XREF GI:93353650 InterPro:IPR001932 LENGTH 304 SQ:AASEQ MRFSVYQESRKGGRRINQDRMGYCFTRDALLMVLADGLGGHALGEVAAQQALQTLARQFQTQARPAIRNPADFLQDTIMLAHREIHRYAEANRLADIPRTTVVCCLIQHGQIHWAHAGDSRFYLMRKGALLTRTRDHSKIENLLQQERVLPMDVANHPERNKLYNCLGSPNLPLIDIGGPVRLNPGDVALLCSDGLWGSLEEDIIVDKVTHLSVVHAIPDLIERALANAGEGADNTTAIAMMWEADANVPNDDAVLTDTLPLNAFTTSILERTGSETDLLSEEEIERSIAEIRAAIDKTSNLMR GT:EXON 1|1-304:0| BL:SWS:NREP 1 BL:SWS:REP 14->237|PRPC_BACSU|8e-21|31.7|221/254| SEG 47->64|aaqqalqtlarqfqtqar| SEG 281->296|seeeiersiaeiraai| BL:PDB:NREP 1 BL:PDB:REP 14->205|2j86A|2e-22|36.8|185/235| RP:PDB:NREP 1 RP:PDB:REP 2->280|1a6qA|9e-25|14.7|279/363| RP:PFM:NREP 1 RP:PFM:REP 28->229|PF00481|8e-07|30.9|191/226|PP2C| HM:PFM:NREP 2 HM:PFM:REP 34->138|PF00481|1.5e-12|24.5|102/257|PP2C| HM:PFM:REP 181->241|PF07228|0.00083|27.9|61/193|SpoIIE| RP:SCP:NREP 1 RP:SCP:REP 1->244|1txoA|1e-31|28.4|232/235|d.219.1.1| HM:SCP:REP 1->245|1txoA_|7.9e-49|35.1|231/0|d.219.1.1|1/1|PP2C-like| OP:NHOMO 524 OP:NHOMOORG 396 OP:PATTERN ------------------------1--1---------------1--1----------1--------1- 2-21111111111111111-111111111111111111111111122-1111212121--32312322211111111111111-------1--1----------------1111111-------1--------1--44444---3111112221111------211-1223------------11211--11111111111111111111111111111113111111111311111111111111111111111111111111111111111---11111111111111111111111111111111111111111111111-11221111111211111111111-211-11-111111-11-11111--13-2-----------1------------------------1--2---1-------1-------1----2-1121--1--------1------------------------------------------------------------11--------12222--1114343333334232411311----------12441---1-------------1-----12214C-1-----------------------------1--21----------1-----------------11-------1-----------------------------------------------------------1------------------------1-----------2---------------------------22222211-23----11---------------1------1-11111111111111-1---------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 280 STR:RPRED 92.1 SQ:SECSTR cTEEEEEEEEEETcccccEEEEEEEEEEEEEEEEEEEEcccHHHHHHHHHHHHHHHTcHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHTTcccccEEcEEEEEEcccEEEEEEEcccEEEEEETTEEEEEcccccTTcHHHHHHHHHTTccEETTEETTTccccccGGGcccccccEccTTTEEEEEEEcHHHHTTccHHHHHHHHHHHHTTcccHHHHHHHHHHHTTccccEEEEEEEcTTcccccHHHHHHHHHHHHHHHHHHHccccccHHHHH######################## DISOP:02AL 64-64,248-264,269-270,272-274,276-276,303-305| PSIPRED cEEEEEEEcccccccccccEEEEEEccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEccEEEEEEEcccEEEEEEccEEEEccccccHHHHHHHcccccHHHHHccccccEEEEEEccccccEEEEEEEEEEccccEEEEEcccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccEEEEEEEEccccccccccccccccccHHHccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHccc //