[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07743.1
DDBJ      :             DNA-directed RNA polymerase, omega subunit
Swiss-Prot:RPOZ_RALME   RecName: Full=DNA-directed RNA polymerase subunit omega;         Short=RNAP omega subunit;         EC=2.7.7.6;AltName: Full=Transcriptase subunit omega;AltName: Full=RNA polymerase omega subunit;

Homologs  Archaea  0/68 : Bacteria  335/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.143.1
:67 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   6->66 2e2iF PDBj 4e-15 18.0 %
:RPS:SCOP  6->66 1i3qF  a.143.1.2 * 1e-15 18.0 %
:HMM:SCOP  1->65 1i6vE_ a.143.1.1 * 5.5e-20 49.2 %
:RPS:PFM   7->59 PF01192 * RNA_pol_Rpb6 2e-06 47.2 %
:HMM:PFM   7->60 PF01192 * RNA_pol_Rpb6 4.7e-17 46.3 54/57  
:BLT:SWISS 1->67 RPOZ_RALME 3e-34 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07743.1 GT:GENE ABF07743.1 GT:PRODUCT DNA-directed RNA polymerase, omega subunit GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 937386..937589 GB:FROM 937386 GB:TO 937589 GB:DIRECTION + GB:PRODUCT DNA-directed RNA polymerase, omega subunit GB:PROTEIN_ID ABF07743.1 GB:DB_XREF GI:93353654 InterPro:IPR003716 InterPro:IPR006110 LENGTH 67 SQ:AASEQ MARITVEDCLKHIPNRFELALAATYRARQLVQGHTPKVEAKDKPTVVALREIASGQVGIEMLKKVPT GT:EXON 1|1-67:0| SW:ID RPOZ_RALME SW:DE RecName: Full=DNA-directed RNA polymerase subunit omega; Short=RNAP omega subunit; EC=2.7.7.6;AltName: Full=Transcriptase subunit omega;AltName: Full=RNA polymerase omega subunit; SW:GN Name=rpoZ; OrderedLocusNames=Rmet_0857; SW:KW Complete proteome; DNA-directed RNA polymerase;Nucleotidyltransferase; Transcription; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->67|RPOZ_RALME|3e-34|100.0|67/67| GO:SWS:NREP 4 GO:SWS GO:0003899|"GO:DNA-directed RNA polymerase activity"|DNA-directed RNA polymerase| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| RP:PDB:NREP 1 RP:PDB:REP 6->66|2e2iF|4e-15|18.0|61/86| RP:PFM:NREP 1 RP:PFM:REP 7->59|PF01192|2e-06|47.2|53/57|RNA_pol_Rpb6| HM:PFM:NREP 1 HM:PFM:REP 7->60|PF01192|4.7e-17|46.3|54/57|RNA_pol_Rpb6| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF01192|IPR006110| GO:PFM GO:0003899|"GO:DNA-directed RNA polymerase activity"|PF01192|IPR006110| GO:PFM GO:0006351|"GO:transcription, DNA-dependent"|PF01192|IPR006110| RP:SCP:NREP 1 RP:SCP:REP 6->66|1i3qF|1e-15|18.0|61/84|a.143.1.2| HM:SCP:REP 1->65|1i6vE_|5.5e-20|49.2|65/0|a.143.1.1|1/1|RPB6/omega subunit-like| OP:NHOMO 335 OP:NHOMOORG 335 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111--11--11--1-11111111111---1--1--1111111111-1111111111111111111111111111111-1111------------1111111111111-----11-1-111111111111111111111111111111111111111111111111111111111111111111111111----11111111--111111111111111-1-------------------------11---11111-11-------------------1-11111------11----11111111111-1111111111111111111111-----1111111111111111-1111111-----------------11111111-111111---11--11111---11111111111111111111111111111---------11---11111-1111111111111-1111111-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 61 STR:RPRED 91.0 SQ:SECSTR #####ccccccccccHHHHHHHHHHHHHHHTTcccccccccccTTHHHHHHHHTTccccEEEEEcT# DISOP:02AL 1-1,67-68| PSIPRED cccccHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHccccHHHHHHccc //