[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07747.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   28->68 PF05157 * GSPII_E_N 0.00046 44.1 34/109  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07747.1 GT:GENE ABF07747.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 941685..941924 GB:FROM 941685 GB:TO 941924 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF07747.1 GB:DB_XREF GI:93353658 LENGTH 79 SQ:AASEQ MPEYDGFKIIYEVVALPKGKWAIMIEIIRREDGEVLMALHNPFPRQPFDTRLEALDNVNRYVGATIDEFEAASRASRAA GT:EXON 1|1-79:0| SEG 71->78|aasrasra| HM:PFM:NREP 1 HM:PFM:REP 28->68|PF05157|0.00046|44.1|34/109|GSPII_E_N| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,74-80| PSIPRED cccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //