[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07752.1
DDBJ      :             Aspartyl/Asparaginyl beta-hydroxylase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  140/915 : Eukaryota  54/199 : Viruses  0/175   --->[See Alignment]
b.82.2
:300 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   75->293 1e5rA PDBj 3e-18 14.5 %
:RPS:SCOP  147->222 1e5rA  b.82.2.4 * 9e-11 25.0 %
:HMM:SCOP  130->222 1e5sA_ b.82.2.4 * 6.6e-14 30.0 %
:RPS:PFM   78->224 PF05118 * Asp_Arg_Hydrox 2e-41 55.6 %
:HMM:PFM   69->224 PF05118 * Asp_Arg_Hydrox 6e-64 47.7 155/163  
:BLT:SWISS 45->223 ASPH_HUMAN 2e-13 29.9 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07752.1 GT:GENE ABF07752.1 GT:PRODUCT Aspartyl/Asparaginyl beta-hydroxylase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 945002..945904 GB:FROM 945002 GB:TO 945904 GB:DIRECTION + GB:PRODUCT Aspartyl/Asparaginyl beta-hydroxylase GB:PROTEIN_ID ABF07752.1 GB:DB_XREF GI:93353663 InterPro:IPR007803 LENGTH 300 SQ:AASEQ MIKWIIVAAYLGAILYVHFRGKVRLPFMRQLLDHSALVAPFNCFMYIFSGVPRTPYIPVERFPDLEKIRSAWPQIRDEGLALIAMRKIKAADKNDDAGFNSFFKYGWKRFYLKWYEAQHPSAEVLCPNTVALLRDMPSVKAAMFAELPPGGKLNPHRDPFAGSLRYHLGLATPNDDRCFIEVDGERHSWRDGQGVVFDETYLHWAENKSETDRLILFCDIERPMRYRWAAAVNHWLGRKVMTAASSPNDENDQTGMINKLFRFVWLGGQYRRRFKAWNKNLYYVTKFGLIIGGVALIVFI GT:EXON 1|1-300:0| BL:SWS:NREP 1 BL:SWS:REP 45->223|ASPH_HUMAN|2e-13|29.9|174/758| TM:NTM 3 TM:REGION 1->19| TM:REGION 30->52| TM:REGION 279->300| RP:PDB:NREP 1 RP:PDB:REP 75->293|1e5rA|3e-18|14.5|214/260| RP:PFM:NREP 1 RP:PFM:REP 78->224|PF05118|2e-41|55.6|142/150|Asp_Arg_Hydrox| HM:PFM:NREP 1 HM:PFM:REP 69->224|PF05118|6e-64|47.7|155/163|Asp_Arg_Hydrox| GO:PFM:NREP 4 GO:PFM GO:0004597|"GO:peptide-aspartate beta-dioxygenase activity"|PF05118|IPR007803| GO:PFM GO:0018193|"GO:peptidyl-amino acid modification"|PF05118|IPR007803| GO:PFM GO:0030176|"GO:integral to endoplasmic reticulum membrane"|PF05118|IPR007803| GO:PFM GO:0055114|"GO:oxidation reduction"|PF05118|IPR007803| RP:SCP:NREP 1 RP:SCP:REP 147->222|1e5rA|9e-11|25.0|72/260|b.82.2.4| HM:SCP:REP 130->222|1e5sA_|6.6e-14|30.0|90/0|b.82.2.4|1/1|Clavaminate synthase-like| OP:NHOMO 261 OP:NHOMOORG 194 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------1---------------------3-1--------111------4---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-------111---------1-1--1---1---------11--1--1-----------1-----------11111111-----1--------------------------------1-11-311112222221222-22--2222-11221111-1111-1-------1-11-----1--------------------------------------11-11--------------------------------------1-----------------------------------------------------------------------111---1-1-111111111111112------------------------------1111-1------------------1111111---3122222222-2222-111------------------------11111121111111----------------------------------------------------------- ------1-----------------------------------------------------------------------------------------------------7--1--112-111-114311-141-12211----111-1-1-1112-1111112-211-111---11----6-------1------11113 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 281 STR:RPRED 93.7 SQ:SECSTR ############cEEEEEEEEEcccTTcccEEEcccccccccGGGGccHHHHHHHHTccHcHHHHHHHHTcccccccEEEEEccccHHHHHHHHHHccccccccccEEEEEEEccccTTTTcccHHHHHHHHHcccccEEEEEETEEEEcEEEEEEcccccccEEEEcccccEccTTEEEEETTEEEcccTTEEEEccTTccEEEEEcccccccEEEEEEcccccccGGGGcccGGGccTTccccccccEEccHHHHHHHHGGGGTccTTTHHHHHHHHHHHHHHEEccTTHH####### PSIPRED cHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEHHcccccHHHHHHHHHHHHHHHHcHHHHEEEEEEEccccccccccccccEEEEEEEEEEcccccEEEEEEccEEEEcccccEEEEEccEEEEEEEcccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //