[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07765.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:81 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   27->73 PF03358 * FMN_red 0.00041 24.4 41/146  
:HMM:PFM   5->36 PF07747 * MTH865 0.0006 31.2 32/75  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07765.1 GT:GENE ABF07765.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(963411..963656) GB:FROM 963411 GB:TO 963656 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF07765.1 GB:DB_XREF GI:93353676 LENGTH 81 SQ:AASEQ MRRYVKSRSELMAILSQCLDNNPECGEVELHAMRVHQPDHTGCNWSAEVDFRQETFTDLAQQMAAARSIIVVMREQYNVLQ GT:EXON 1|1-81:0| HM:PFM:NREP 2 HM:PFM:REP 27->73|PF03358|0.00041|24.4|41/146|FMN_red| HM:PFM:REP 5->36|PF07747|0.0006|31.2|32/75|MTH865| OP:NHOMO 10 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2221--111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,81-82| PSIPRED cccHHccHHHHHHHHHHHHHccccccEEEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccc //