[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07779.1
DDBJ      :             molybdopterin dehydrogenase, FAD-binding
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  385/915 : Eukaryota  142/199 : Viruses  0/175   --->[See Alignment]
a.56.1d.145.1d.15.4d.87.2
:498 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->452 2w3rA PDBj 1e-95 47.7 %
:RPS:PDB   4->472 2ckjA PDBj 2e-80 26.0 %
:RPS:SCOP  4->90 1dgjA2  d.15.4.2 * 1e-13 29.9 %
:RPS:SCOP  94->165 1ffuA1  a.56.1.1 * 1e-25 48.5 %
:RPS:SCOP  204->369 1rm6B2  d.145.1.3 * 8e-30 27.9 %
:RPS:SCOP  373->485 1jroA3  d.87.2.1 * 3e-28 46.9 %
:HMM:SCOP  3->91 1fo4A2 d.15.4.2 * 7.1e-21 34.8 %
:HMM:SCOP  86->217 1dgjA1 a.56.1.1 * 2.3e-36 47.7 %
:HMM:SCOP  191->370 1fo4A6 d.145.1.3 * 5.8e-53 36.7 %
:HMM:SCOP  370->478 1fo4A4 d.87.2.1 * 9.2e-36 46.8 %
:RPS:PFM   86->162 PF01799 * Fer2_2 2e-21 62.5 %
:RPS:PFM   201->366 PF00941 * FAD_binding_5 7e-27 39.2 %
:RPS:PFM   374->474 PF03450 * CO_deh_flav_C 7e-15 45.5 %
:HMM:PFM   202->367 PF00941 * FAD_binding_5 4.8e-46 35.5 166/171  
:HMM:PFM   374->474 PF03450 * CO_deh_flav_C 3.6e-34 44.6 101/103  
:HMM:PFM   86->164 PF01799 * Fer2_2 3.8e-31 55.4 74/75  
:HMM:PFM   12->72 PF00111 * Fer2 2.8e-07 31.7 60/77  
:BLT:SWISS 1->432 XDH_DROME 1e-57 37.7 %
:PROS 43->51|PS00197|2FE2S_FER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07779.1 GT:GENE ABF07779.1 GT:PRODUCT molybdopterin dehydrogenase, FAD-binding GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(979504..981000) GB:FROM 979504 GB:TO 981000 GB:DIRECTION - GB:PRODUCT molybdopterin dehydrogenase, FAD-binding GB:PROTEIN_ID ABF07779.1 GB:DB_XREF GI:93353690 InterPro:IPR001041 InterPro:IPR002346 InterPro:IPR002888 InterPro:IPR005107 InterPro:IPR006058 LENGTH 498 SQ:AASEQ METQTIRFYHRGQVQEVSDAPVTRTLLQYLREDVRCTGTKEGCAEGDCGACTVVIGELQDSGDVEFKAVNACIQFLPTLDGKALITVEDLRQADGALHPVQEAMVECHGSQCGFCTPGFVMSLWALYQQHTPGGEPPPRQTICDALTGNLCRCTGYRPIIDAGQRMMALPAPQADRIDPRQIADTLRNLKRGETFHYNARGQHFYAPRTAAEFGAIKAAEPNIRILAGSTDVGLWVTKQFRELGNLLYVGQVEDLNQIAEHDGFIEIGAAVTLEKAYAALNTAHPELEELWKRFASLPIRNAGTLGGNIANGSPIGDSMPALIALGTQVVLQRGDVRRVMPLEDLYLAYQKTAMVEGEFVAGLRVPVQGPQHFRTYKLSKRFDEDISAVCAAFGITVENGIVTAACIAFGGMAATPKRAVLAEDALTGKPWNEATARAGMAALGQDYTPLTDMRATADYRSRGAANLLYRFWLETRDSALPAAMVNVRAIGAGETVSA GT:EXON 1|1-498:0| BL:SWS:NREP 1 BL:SWS:REP 1->432|XDH_DROME|1e-57|37.7|427/1335| PROS 43->51|PS00197|2FE2S_FER_1|PDOC00175| BL:PDB:NREP 1 BL:PDB:REP 6->452|2w3rA|1e-95|47.7|413/450| RP:PDB:NREP 1 RP:PDB:REP 4->472|2ckjA|2e-80|26.0|462/1264| RP:PFM:NREP 3 RP:PFM:REP 86->162|PF01799|2e-21|62.5|72/75|Fer2_2| RP:PFM:REP 201->366|PF00941|7e-27|39.2|166/171|FAD_binding_5| RP:PFM:REP 374->474|PF03450|7e-15|45.5|101/102|CO_deh_flav_C| HM:PFM:NREP 4 HM:PFM:REP 202->367|PF00941|4.8e-46|35.5|166/171|FAD_binding_5| HM:PFM:REP 374->474|PF03450|3.6e-34|44.6|101/103|CO_deh_flav_C| HM:PFM:REP 86->164|PF01799|3.8e-31|55.4|74/75|Fer2_2| HM:PFM:REP 12->72|PF00111|2.8e-07|31.7|60/77|Fer2| GO:PFM:NREP 5 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01799|IPR002888| GO:PFM GO:0046872|"GO:metal ion binding"|PF01799|IPR002888| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01799|IPR002888| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00941|IPR002346| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00941|IPR002346| RP:SCP:NREP 4 RP:SCP:REP 4->90|1dgjA2|1e-13|29.9|77/80|d.15.4.2| RP:SCP:REP 94->165|1ffuA1|1e-25|48.5|68/76|a.56.1.1| RP:SCP:REP 204->369|1rm6B2|8e-30|27.9|165/216|d.145.1.3| RP:SCP:REP 373->485|1jroA3|3e-28|46.9|113/117|d.87.2.1| HM:SCP:REP 3->91|1fo4A2|7.1e-21|34.8|89/90|d.15.4.2|1/1|2Fe-2S ferredoxin-like| HM:SCP:REP 86->217|1dgjA1|2.3e-36|47.7|111/113|a.56.1.1|1/1|CO dehydrogenase ISP C-domain like| HM:SCP:REP 191->370|1fo4A6|5.8e-53|36.7|180/223|d.145.1.3|1/1|FAD-binding domain| HM:SCP:REP 370->478|1fo4A4|9.2e-36|46.8|109/117|d.87.2.1|1/1|CO dehydrogenase flavoprotein C-terminal domain-like| OP:NHOMO 1900 OP:NHOMOORG 549 OP:PATTERN 225-1-4544446644--32221-2---2--------------------------------2------ 13924---------1--22-23--692222244444138C211411---11-2121----1-D-24A566--------1---6---1--------------1-245-4----------------------------33321----8-1-1-----------------1-3--------------32-------1-----1---------23---1----31-----------1--------------------1----------------------------------------------------------------------75-35555455546-4------31-31-113-311454-425-------4--4121-----24FJJ413374B6111111111-1-BAH98FAC592-62241195319F8523-87144446493333333363331621------------------------------2341-65445BBBBBB22221BBBB22221285JEEG4-2675433117251B2131-1111-----------3211-4-5111131111--2224111511-133-5-------------------------222--4112-4-112222232111111--1-1----2---------1--2--3332322132-3333222323322332331------------------------52--2222-----------------------------321---------------1111111-214166663284464553433---------1---3----------1122222----------3--------------1----------------------------3432-----13- ----111-----11-21222121121222233211111111112222211122211111111-----------1-----------------11-------1-1----263F23223822222426E251352-324121242262-2221B2192624426N287486AD8B356-13-8---2244672751121112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 491 STR:RPRED 98.6 SQ:SECSTR cccccEEEEETTEEEEEccccTTccHHHHHHHHccccccccccccccccTTEEEEEEEcccccEEEEEEETTcccGGGGTTcEEEcGGGTccTTccccHHHHHHHHTTcccccccHHHHHHHHHHHHHHcccccccccHHHHTTcGGGccccccccHHHHHHHHTTcccccccTTccccccGGGHHcTTcccccEEEEccccEEEEcccHHHHHHHHHHcTTcEEccccTTHHHHHHHccccccEEEEccccGGGccEEEcccEEEEETTccHHHHHHHHHHHHHHHHHHHTTcccHHHHTTccHHHHHHcccTTcccHHHHHHHTcccEEEcTTccccccccTTccccTTcccccTcEEEEEEEEccTcccTTEEEEEEEEccccccEEEEEEccTTcccccEEEEEEETcccccEEcTHHHHHHTTccccHHHHHHHHHHHHHHTcccTcTTccHHHHHHHHHHHHHHHHHHHHTTTTccccccccccc####### DISOP:02AL 1-1,185-198,482-499| PSIPRED ccccEEEEEEccEEEEEEcccccccHHHHHHHHcccccccccccccccccEEEEEcccccccccccEEHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccEEEccccEEEEEcccHHHHHHHHHcccccEEEEcccHHHHHHHHccccccEEEEccccccccEEEEEccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHcccEEEEEccccEEEEEHHHHHHcccccccccccEEEEEEEcccccccEEEEEEcccccccEEEEEEEEEEEEEccEEEEEEEEEEcccccEEEHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc //