[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07792.1
DDBJ      :             PGAP1-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:344 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   134->325 3ds8A PDBj 2e-06 13.5 %
:RPS:SCOP  134->237 1cvlA  c.69.1.18 * 6e-05 24.2 %
:HMM:SCOP  123->319 1ei9A_ c.69.1.13 * 1.5e-29 30.2 %
:RPS:PFM   192->235 PF07819 * PGAP1 9e-05 47.6 %
:HMM:PFM   192->236 PF07819 * PGAP1 1.9e-09 48.8 43/225  
:HMM:PFM   4->116 PF03706 * UPF0104 7.9e-06 16.9 89/294  
:HMM:PFM   123->161 PF12146 * Hydrolase_4 0.00089 35.1 37/79  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07792.1 GT:GENE ABF07792.1 GT:PRODUCT PGAP1-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(992946..993980) GB:FROM 992946 GB:TO 993980 GB:DIRECTION - GB:PRODUCT PGAP1-like protein GB:PROTEIN_ID ABF07792.1 GB:DB_XREF GI:93353703 InterPro:IPR000379 InterPro:IPR012908 LENGTH 344 SQ:AASEQ MSLTAAALRRIAVVVQAAAVGGLAAALAAGADWSWPAALLASIAGALVAFGIGVAIAFLVTRAGLAIPDSARPQRPDDIPAPGPLSWRHAMSCYLAECRAILRMFDWLQPFRSRLTFAQPTDPLPDTPTVLLVHGYGCNHAVWLDLAPALAGAGYRCEGIDLTPVLGDIDDYAAALLARMRDLRARTGHPPLLVCHSMGGLAARAAQVMADAAGESVPCAGIVTLGSPHRGCPLATFGAGTNARQMRWASPWLTNLAEAESPAMRGRMISVFSWHDSIAGPADTAWLEGARHIPLSGIGHVSLLRDPRAVQATLDGLATLRKQPAATSDSALSLPHGNASARFM GT:EXON 1|1-344:0| TM:NTM 2 TM:REGION 11->30| TM:REGION 42->64| SEG 5->31|aaalrriavvvqaaavgglaaalaaga| SEG 120->133|ptdplpdtptvllv| SEG 170->186|ddyaaallarmrdlrar| SEG 202->213|aaraaqvmadaa| RP:PDB:NREP 1 RP:PDB:REP 134->325|3ds8A|2e-06|13.5|192/245| RP:PFM:NREP 1 RP:PFM:REP 192->235|PF07819|9e-05|47.6|42/98|PGAP1| HM:PFM:NREP 3 HM:PFM:REP 192->236|PF07819|1.9e-09|48.8|43/225|PGAP1| HM:PFM:REP 4->116|PF03706|7.9e-06|16.9|89/294|UPF0104| HM:PFM:REP 123->161|PF12146|0.00089|35.1|37/79|Hydrolase_4| GO:PFM:NREP 4 GO:PFM GO:0006505|"GO:GPI anchor metabolic process"|PF07819|IPR012908| GO:PFM GO:0006886|"GO:intracellular protein transport"|PF07819|IPR012908| GO:PFM GO:0016788|"GO:hydrolase activity, acting on ester bonds"|PF07819|IPR012908| GO:PFM GO:0031227|"GO:intrinsic to endoplasmic reticulum membrane"|PF07819|IPR012908| RP:SCP:NREP 1 RP:SCP:REP 134->237|1cvlA|6e-05|24.2|99/316|c.69.1.18| HM:SCP:REP 123->319|1ei9A_|1.5e-29|30.2|192/279|c.69.1.13|1/1|alpha/beta-Hydrolases| OP:NHOMO 22 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--11111111111-----1------------------1----------------------1------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 192 STR:RPRED 55.8 SQ:SECSTR #####################################################################################################################################ccTTccTTTTHHHHHHHTTcccccEEEEEETTTEccHHHHHHHHHHHHHHHHHHcccEEEEEETHHHHHHHHHHHHcTTcTTccEEEEEEEEcccTTcHccTTccccccccHHHHHHHTGGGccTTcEEEEEEEEccTTccccccccHHHHTGGGGTcTEEcGGGcGGGGGGcHHHHHHHHHHHHTcccccc################### DISOP:02AL 1-6,70-70,72-78,339-342| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHcccccccccccccccEEEEEccccccHHHHHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHHHccccccccEEEEccccccccccccccccccHHHHccccHHHHHHccccccccEEEEEEEEcccccEEEcccccccccccEEEEccccHHHHcccHHHHHHHHHHHHHccccccccccHHEEccccccccccc //