[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07837.1
DDBJ      :             cytochrome C oxidase subunit IV
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  233/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:116 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   23->104 PF03626 * COX4_pro 8e-11 50.0 %
:HMM:PFM   23->105 PF03626 * COX4_pro 8.6e-36 61.4 83/83  
:BLT:SWISS 20->112 CYOD_SHIFL 5e-19 44.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07837.1 GT:GENE ABF07837.1 GT:PRODUCT cytochrome C oxidase subunit IV GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1036952..1037302 GB:FROM 1036952 GB:TO 1037302 GB:DIRECTION + GB:PRODUCT cytochrome C oxidase subunit IV GB:PROTEIN_ID ABF07837.1 GB:DB_XREF GI:93353748 InterPro:IPR005171 LENGTH 116 SQ:AASEQ MAQQHASTAAHGASHGHSSVKSYVIGFVLAVILTVIPFKIVMDGTMERGTMLWIILGMAAVQIVVHLKYFLHLDGSNGQRWNVMALLFTVLILFIVLAGSLWIMHNMNANMMPWMK GT:EXON 1|1-116:0| BL:SWS:NREP 1 BL:SWS:REP 20->112|CYOD_SHIFL|5e-19|44.1|93/109| TM:NTM 3 TM:REGION 20->42| TM:REGION 48->70| TM:REGION 82->104| SEG 5->19|hastaahgashghss| SEG 85->98|allftvlilfivla| RP:PFM:NREP 1 RP:PFM:REP 23->104|PF03626|8e-11|50.0|82/83|COX4_pro| HM:PFM:NREP 1 HM:PFM:REP 23->105|PF03626|8.6e-36|61.4|83/83|COX4_pro| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF03626|IPR005171| OP:NHOMO 261 OP:NHOMOORG 235 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------11-----1--111-----11-11111111111-11111111-1-11111111111111------1-----1-11111111----1------------------------------------1-1111-1111111222211122222121212333--222-11111---1-11--1--1-----------------------1-------------------------------------------------1111----11---111-1-1-11---11---------------11111111111111111-1111111111111111111111111111111111111111111111-11111-11-1111111111-1-----------1-11---------------1111111----------211----1-111----------1--------11---22111111111111----------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-16,116-117| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccc //