[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07841.1
DDBJ      :             ABC transporter-related protein
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  892/915 : Eukaryota  141/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:282 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   34->281 1g6hA PDBj 1e-19 32.3 %
:RPS:PDB   34->281 2d3wB PDBj 8e-31 23.6 %
:RPS:SCOP  33->281 1ji0A  c.37.1.12 * 4e-28 24.5 %
:HMM:SCOP  31->281 1g6hA_ c.37.1.12 * 3.7e-47 32.5 %
:RPS:PFM   74->209 PF00005 * ABC_tran 7e-08 30.9 %
:HMM:PFM   74->208 PF00005 * ABC_tran 1e-20 36.9 111/118  
:HMM:PFM   260->281 PF12399 * BCA_ABC_TP_C 2.7e-09 59.1 22/23  
:HMM:PFM   48->94 PF03193 * DUF258 0.00023 15.2 46/161  
:BLT:SWISS 33->281 BRAF_PSEAE 7e-29 34.0 %
:PROS 181->195|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07841.1 GT:GENE ABF07841.1 GT:PRODUCT ABC transporter-related protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1041819..1042667 GB:FROM 1041819 GB:TO 1042667 GB:DIRECTION + GB:PRODUCT ABC transporter-related protein GB:PROTEIN_ID ABF07841.1 GB:DB_XREF GI:93353752 InterPro:IPR001687 InterPro:IPR003439 LENGTH 282 SQ:AASEQ MNSVLGEGKAESGDATGLGRIVEPGVIDTTHGPILYIEDLTVQFDGFRALNKLSLSIDHGELRCVIGPNGAGKTTMMDVITGKTGPRNANVTGRVFLGQTIDLMRLTEPRIAQTGIGRKFQKPTVFEQHAVWENLELAMKADKRWWASLRARLTLEGHRRIEETLALTGLEDEAYRPAGLLSHGQKQRLEIGMLLTQQPQLLLLDEPVAGMTDEETMQLAALLNSLRGSCSMMVVEHDMEFVAALAGDAGTVTVLAEGSLLAEGTLDAVKRDERVIESYLGR GT:EXON 1|1-282:0| BL:SWS:NREP 1 BL:SWS:REP 33->281|BRAF_PSEAE|7e-29|34.0|241/255| PROS 181->195|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 194->204|lltqqpqllll| BL:PDB:NREP 1 BL:PDB:REP 34->281|1g6hA|1e-19|32.3|235/254| RP:PDB:NREP 1 RP:PDB:REP 34->281|2d3wB|8e-31|23.6|242/244| RP:PFM:NREP 1 RP:PFM:REP 74->209|PF00005|7e-08|30.9|123/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 74->208|PF00005|1e-20|36.9|111/118|ABC_tran| HM:PFM:REP 260->281|PF12399|2.7e-09|59.1|22/23|BCA_ABC_TP_C| HM:PFM:REP 48->94|PF03193|0.00023|15.2|46/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 33->281|1ji0A|4e-28|24.5|233/240|c.37.1.12| HM:SCP:REP 31->281|1g6hA_|3.7e-47|32.5|243/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 15250 OP:NHOMOORG 1100 OP:PATTERN EE62593366556565M4DBBCABS58BM6HJ52845123533CH5EE96OHD59C8DDA8411H-23 76F8bC7GGGICB675322-2F445V222225IIGIJXUO9QCTEHD9FCA9JHH48944EHUCHGKXUTIACCCLEEG5BAH3223599A819341--266233A4A48111111121211115985859689C7IJINP887NIHGDEBBGDHBB647755FEEFLNG8664364674365OIDDADA2ACFSSTRTOXYKVbROPYOKHHCGUWTAPRJNCJFJJKFEhb66667665666665645544IB8CGJB6ADCII99IJA86DIABBCIHHHHEHILKGFFHEEEHFIGEEEEEFGGFFEEFLLKGGGLKMFFOFQbLKLNOILALBIEIIBDDCQJMA8VDIHCZa7LIELC9HGDCK8AC89CDCC845646AE***JBOpZlmYVVQUUQXVTRt-HPqLDmIdes92***y*s******qr566PTpURYXWNY66666666V8946S9W112--111--1111112111121121111723324UxkQjXVYWfWKHHIHXXwiNLLMGPYd*bgkU49OPMSFOKPgXudu*EHH4738B94445444D9AFGIDbfDGGVIEPFKKO8CCD9BGGC8EFCDFNBc444645555452322222222632266HGR5G6B798IAA9BC6BFBBBC8DB9D991-38553------YNZRASJSSSQSRQRQR-SSQRRPTQRQSSSQQRQQOejfVYDDALKGJIKKLKKIIKIJIWKIIMNMO81NYYYYYYWWWYY-124354546566A6JMXBBCGBD49A8ABCFB89A7968688JDHFDGCQKaFPJNGGSQR1111111116CEDJJKLKKHLCHJ65565665556666119B33232344333333867233-3--131311111241212---BFH75BPCIC6E8 ----681-D814352331-11111-1-3311112222212122222322212321-2111211----------------------------131-----1------133-6341512212-161BC16-BU5-53533313236414222521H2662I16I163629ACG37541-3-E11--23119-71-1B8CB1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,5-32| PSIPRED cccccccccccccccccccccccccccccccccEEEEEEEEEEEccEEEEcccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEEEEcccccccccccHHHHHHcccccccccccccccccHHHHHHHHHHHccccccHHccccHHHHHHHHHHHHHHcccHHHcccccHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHccccEEEEEEccEEEEEccHHHHHHcHHHHHHHccc //