[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07845.1
DDBJ      :             HupE/UreJ protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  66/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:211 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   13->188 PF04955 * HupE_UreJ 1e-16 41.6 %
:HMM:PFM   14->208 PF04955 * HupE_UreJ 7.6e-62 58.4 178/180  
:BLT:SWISS 4->181 HUPE_RHILV 1e-22 40.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07845.1 GT:GENE ABF07845.1 GT:PRODUCT HupE/UreJ protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1044734..1045369 GB:FROM 1044734 GB:TO 1045369 GB:DIRECTION + GB:PRODUCT HupE/UreJ protein GB:PROTEIN_ID ABF07845.1 GB:DB_XREF GI:93353756 InterPro:IPR007038 LENGTH 211 SQ:AASEQ MHRMLRSRLTAGVAMSLASVSAFAHPGHDAATVGASLWAGLAHPFTGADHLLAMAAVGVWSALASSPRSAFGQTSKMDLMRLPLAFVAMMLVGAALGLAGVTLPAVEPMIAVSLLVIGLLVAARARLSAWAGMAIVGGFALFHGYAHGAELPATAAALPSVLAYVGGFAVATMTLHVLGIGAGAFLRRHAGWLARVAGAGVALYGVGLLVA GT:EXON 1|1-211:0| BL:SWS:NREP 1 BL:SWS:REP 4->181|HUPE_RHILV|1e-22|40.9|159/100| TM:NTM 5 TM:REGION 78->100| TM:REGION 103->124| TM:REGION 128->148| TM:REGION 157->179| TM:REGION 190->211| SEG 87->101|vammlvgaalglagv| SEG 190->210|agwlarvagagvalygvgllv| RP:PFM:NREP 1 RP:PFM:REP 13->188|PF04955|1e-16|41.6|161/183|HupE_UreJ| HM:PFM:NREP 1 HM:PFM:REP 14->208|PF04955|7.6e-62|58.4|178/180|HupE_UreJ| OP:NHOMO 70 OP:NHOMOORG 66 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------1--------------------------------------------------------------1--------------1-1---------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1---1-1------------2----------1---112-11-121-11---1-1-----------------------------------------------------------111-------------------------1111-1111-----11-111-1--1--1-----------------------------------------------------------------------------1----1-11111---111111--11------------------1-------------------------------------------------------------------------------------------1---2-----------------------1-1--------11----1---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHc //