[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07850.1
DDBJ      :             urease accessory protein UreG
Swiss-Prot:UREG_RALME   RecName: Full=Urease accessory protein ureG;

Homologs  Archaea  18/68 : Bacteria  388/915 : Eukaryota  86/199 : Viruses  0/175   --->[See Alignment]
c.37.1c.71.1
:207 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->201 2hf9B PDBj 5e-14 33.3 %
:RPS:PDB   149->202 1a2kC PDBj 2e-04 18.0 %
:RPS:SCOP  22->183 1ai9A  c.71.1.1 * 1e-19 12.7 %
:HMM:SCOP  10->201 1yrbA1 c.37.1.10 * 4.5e-28 27.3 %
:RPS:PFM   22->175 PF02492 * cobW 2e-10 41.0 %
:HMM:PFM   12->182 PF02492 * cobW 4e-40 33.5 161/173  
:BLT:SWISS 1->207 UREG_RALME e-109 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07850.1 GT:GENE ABF07850.1 GT:PRODUCT urease accessory protein UreG GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1048776..1049399 GB:FROM 1048776 GB:TO 1049399 GB:DIRECTION + GB:PRODUCT urease accessory protein UreG GB:PROTEIN_ID ABF07850.1 GB:DB_XREF GI:93353761 InterPro:IPR001687 InterPro:IPR003495 InterPro:IPR004400 LENGTH 207 SQ:AASEQ MTRTKKNPPLRVGVGGPVGSGKTTLLEMLCKAMRDRYDLVAITNDIYTKEDQRLLTISGALPAERIMGVETGGCPHTAIREDASINLEAVDRMLAKFPDADVVFIESGGDNLAATFSPELSDLTIYVIDVAGGEKIPRKGGPGITKSDLLVINKTDLAPYVGASLEIMESDARKMRGERPFVMGSVKSGQGLDQVIAFIERQGMLDV GT:EXON 1|1-207:0| SW:ID UREG_RALME SW:DE RecName: Full=Urease accessory protein ureG; SW:GN Name=ureG; OrderedLocusNames=Rmet_0964; SW:KW Chaperone; Complete proteome; Cytoplasm; GTP-binding;Nickel insertion; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->207|UREG_RALME|e-109|100.0|207/207| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| SEG 12->21|vgvggpvgsg| BL:PDB:NREP 1 BL:PDB:REP 22->201|2hf9B|5e-14|33.3|165/209| RP:PDB:NREP 1 RP:PDB:REP 149->202|1a2kC|2e-04|18.0|50/196| RP:PFM:NREP 1 RP:PFM:REP 22->175|PF02492|2e-10|41.0|144/174|cobW| HM:PFM:NREP 1 HM:PFM:REP 12->182|PF02492|4e-40|33.5|161/173|cobW| RP:SCP:NREP 1 RP:SCP:REP 22->183|1ai9A|1e-19|12.7|157/192|c.71.1.1| HM:SCP:REP 10->201|1yrbA1|4.5e-28|27.3|183/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 559 OP:NHOMOORG 492 OP:PATTERN ---1-11--------1-------11---1--1-1-111----11--1----1-1------------1- 1-2-1--1111-111--11-13--1211111111111211-111--1-----11111-------1-2113-----1-------11-1--------------1---11--------------------1--------1--11---1-1-11--211--1111-1121-111111-11111-1-1--1--------------1---------1--------1-1----------1-11111111111111111-1---------------------------------------------------------------111---------------------------1-11------11--1-1----------------------11134---1111122222222211-3413313211--111111111111111--111111111111111111----11-1------------------------------------111-1111111111111211111111111111-1111111--111111-11-1-1-1---------1-11-----1-11----11---1-----1111-1--1----------111111111---------1111---11-------1--------------11-1------1-1-21-1231111111-2111111111211111111111--1111111111111111111-1111111--11111111111111------------1211111----1111----1111111-2-2-11111111111111212-----------11---------------------------1----------------------------------------111----------11- -------------11111-1121111111111111111-111111111111111-11111--------------------------11-12111111111111111----2----------------------------------------------------21-----3--2-----8111--11321111111112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 181 STR:RPRED 87.4 SQ:SECSTR #####################HHHHHHHHHccccccccEEEEETTEEEEEcccHHHTTTcccHHEEccTccHHHHHHHHHHHHHHHHHTGGGccEEEEEEETTHHEEEHHHHHHHHHTTcccHHHHHHHHHHHTTccETccHHHHHTcEEEEEcTTcccccccccccHHHHcccccccEEEEEccGGGTcTTTHHHHHHHHH##### DISOP:02AL 1-7| PSIPRED cccccccccEEEEccccccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHcccccccEEEEcccccccccccccHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccEEEEEEEEccccccccccccccEEEEEEEEEEcHHHHHHHcccHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHcccc //