[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07858.1
DDBJ      :             aminoglycoside phosphotransferase
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  162/915 : Eukaryota  156/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:358 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->356 3dxpA PDBj e-140 87.1 %
:RPS:PDB   19->66 3dxpA PDBj 8e-04 71.7 %
:RPS:PDB   24->351 3dxqB PDBj 1e-31 11.5 %
:RPS:SCOP  25->261 1nd4A  d.144.1.6 * 1e-18 15.6 %
:HMM:SCOP  1->328 1nw1A_ d.144.1.8 * 2.9e-60 22.3 %
:RPS:PFM   47->253 PF01636 * APH 4e-23 34.7 %
:HMM:PFM   42->289 PF01636 * APH 5.6e-55 27.7 231/238  
:BLT:SWISS 11->357 ACD10_HUMAN 1e-91 49.7 %
:PROS 217->229|PS00109|PROTEIN_KINASE_TYR

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07858.1 GT:GENE ABF07858.1 GT:PRODUCT aminoglycoside phosphotransferase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1057635..1058711) GB:FROM 1057635 GB:TO 1058711 GB:DIRECTION - GB:PRODUCT aminoglycoside phosphotransferase GB:PROTEIN_ID ABF07858.1 GB:DB_XREF GI:93353769 InterPro:IPR002575 InterPro:IPR008266 LENGTH 358 SQ:AASEQ MSTNVSHFEGTRPVADQQRFDVGALESWMREHVDGFAGPLTVEQFKGGQSNPTFKLITPGQTYVMRAKPGPKAKLLPSAHAIEREYRVMAALAGTDVPVARMFALCEDEEVIGRAFYIMEFVGGRVLWDQSLPDMTKSERGAIYDEMNRVIAALHTVDYKAIGLADYGKPGNYFQRQIERWSKQYKLSETESIPAMDQLMAWLPDHIPQEDVDLTSIVHGDYRLDNLMFHPTEPKVLAVLDWELSTLGHPMADFGYHCMSWHIQPGQFRGIAGLDYQALGIPDEATYRRLYEQRTGRQITGDWNFYLAFSMFRIAGILQGIMKRVVDGTASSAQATDAGKRARPMAEMGWAYAQKSGA GT:EXON 1|1-358:0| BL:SWS:NREP 1 BL:SWS:REP 11->357|ACD10_HUMAN|1e-91|49.7|342/1059| PROS 217->229|PS00109|PROTEIN_KINASE_TYR|PDOC00100| BL:PDB:NREP 1 BL:PDB:REP 19->356|3dxpA|e-140|87.1|310/312| RP:PDB:NREP 2 RP:PDB:REP 19->66|3dxpA|8e-04|71.7|46/312| RP:PDB:REP 24->351|3dxqB|1e-31|11.5|269/280| RP:PFM:NREP 1 RP:PFM:REP 47->253|PF01636|4e-23|34.7|190/221|APH| HM:PFM:NREP 1 HM:PFM:REP 42->289|PF01636|5.6e-55|27.7|231/238|APH| RP:SCP:NREP 1 RP:SCP:REP 25->261|1nd4A|1e-18|15.6|218/255|d.144.1.6| HM:SCP:REP 1->328|1nw1A_|2.9e-60|22.3|301/395|d.144.1.8|1/1|Protein kinase-like (PK-like)| OP:NHOMO 593 OP:NHOMOORG 323 OP:PATTERN ------------------------111---11------------------------------------ ----3------1-149622-24--65222225488845BC-9-7----------------114-1321111-----------1-------------------------------------------------------------1--------------1-----------------------111-----1--------------------------11111---------------------------------------------------------------------------------------------------------------------------------------------------------4114-------222---11222--------------1--1-2-14--------------213211-----1-2--------1-----1-------------------------------1222-----11111112222211122222131131543-1111-1122111211-----------------------211------------------------11--------------------------------21--12--------2-----1--------------------------------------------------------------------------------------------------------------------11-----------------11111-2-11--11111111121111111------------------------------------------------------------------------------------------------- ------1-----111122231112211111111111111121111111111-1211111111--1----2--1-1------11111---12121111111111211-2313121-131111111411319J2-326111121134-1111211413222266111------1141-111511111211511211-111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 328 STR:RPRED 91.6 SQ:SECSTR ##################cccHHHHHHHHTTcTTGGTTccccEEEccccccEEEEEEcccTTEEEEcccc#####EEcccEccHHHHHHHHHHHHTTccccEEEEcTTTccEETTccEEEccTTcEEcHHHHHHHHHHHcTTHHHHHHHHHHHHHTccccccccccHHHHHHHHHHHHHHHHTTccccccTTHHHHHHHHHHHHHHHHTcccccEEEEcccccGGGEEEccccEEccEEcccTTcEEEcHHHHHHHHHHHTTccHHHHHHHHHTccccHHHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHHcHHHH####### DISOP:02AL 1-6,328-332,357-359| PSIPRED ccccccccccccccccHHHccHHHHHHHHHHHccccccccEEEEEcccccccEEEEEEcccEEEEEEccccHHHHcccHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccEEEEEccccEEccccccccccHHHHHHHHHHHHHHHHHHHcccHHHcccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHccccEEEEEcccccccEEEcccccEEEEEEEccccccccHHHHHHHHHHHEEcccccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcc //