[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07863.1
DDBJ      :             Protein of unknown function DUF132
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.120.1
:179 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   15->169 2dokB PDBj 4e-07 12.8 %
:RPS:SCOP  26->142 1v8oA  c.120.1.1 * 1e-04 15.9 %
:HMM:SCOP  28->154 2fe1A1 c.120.1.1 * 1.2e-08 30.3 %
:HMM:PFM   29->146 PF01850 * PIN 2e-07 18.3 115/126  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07863.1 GT:GENE ABF07863.1 GT:PRODUCT Protein of unknown function DUF132 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1063220..1063759) GB:FROM 1063220 GB:TO 1063759 GB:DIRECTION - GB:PRODUCT Protein of unknown function DUF132 GB:PROTEIN_ID ABF07863.1 GB:DB_XREF GI:93353774 InterPro:IPR002850 LENGTH 179 SQ:AASEQ MHTTHTGHDANSSAGPDAGALSVTSAPRVVLDSNIWVDLLVFRDPHVEPIRAALAAGAIAPVIRADCREELRRVLAYPQFTRFAVDIDAALAEVDRFTTLEPVPTQEDADAIRLPKCKDTDDQKFIELAHFSRAALLVSKDKAVLKLRSRLRRSSGVEVLPPLAFGGWLAAWVPPDDRG GT:EXON 1|1-179:0| SEG 49->65|piraalaagaiapvira| SEG 145->155|lklrsrlrrss| RP:PDB:NREP 1 RP:PDB:REP 15->169|2dokB|4e-07|12.8|148/168| HM:PFM:NREP 1 HM:PFM:REP 29->146|PF01850|2e-07|18.3|115/126|PIN| RP:SCP:NREP 1 RP:SCP:REP 26->142|1v8oA|1e-04|15.9|107/132|c.120.1.1| HM:SCP:REP 28->154|2fe1A1|1.2e-08|30.3|122/0|c.120.1.1|1/1|PIN domain-like| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111------11-------111111--111--1111-1-1-111------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 82.7 SQ:SECSTR ##############cccccEEEEEEEEEEEEcHHHHHH#######HHHHHHHHHHHcccEEEEEHHHHHHHHHHHHcccHHHHHHHHHHHHHHHTTcTTEEEEcTTccEEcccTTcccccHHHHHHHHHHHTccccGGGGcccEcHHHHHHHHHTTccEEcHHHHHHHH########## DISOP:02AL 1-20,177-180| PSIPRED cccccccccccccccccccccccccccEEEEEHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHccccEEEEccHHHHHHHHHHHHcccccEEcHHHHHHHHHHHccccccc //