[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07864.1
DDBJ      :             protein of unknown function DUF328
Swiss-Prot:Y978_RALME   RecName: Full=UPF0246 protein Rmet_0978;

Homologs  Archaea  0/68 : Bacteria  359/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
:261 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->248 PF03883 * DUF328 2e-73 55.6 %
:HMM:PFM   1->248 PF03883 * DUF328 1.6e-98 55.3 237/237  
:BLT:SWISS 1->261 Y978_RALME e-151 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07864.1 GT:GENE ABF07864.1 GT:PRODUCT protein of unknown function DUF328 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1063800..1064585 GB:FROM 1063800 GB:TO 1064585 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF328 GB:PROTEIN_ID ABF07864.1 GB:DB_XREF GI:93353775 InterPro:IPR005583 LENGTH 261 SQ:AASEQ MLIVLSPAKSLDYETPPRVKSHTLPRFIDRSATLIERLRKLAPQDVASLMDISDKLAVLNVTRYADWSPEFTAANSKQAVLAFNGDVYDGLDAKTLSTDDLAFAQKHIRILSGLYGVLRPMDWMQPYRLEMGTRLDNAAGKDLYAFWGDDVTALINKDMAELKHEGSLTLVNLASEEYFKVVRPKVLAARVITPVFEDWKGGRYKIISFHAKRARGTMARYAVTHRVTDPAQLKRFNEDGYAFDKAASDDARWVFRRRLED GT:EXON 1|1-261:0| SW:ID Y978_RALME SW:DE RecName: Full=UPF0246 protein Rmet_0978; SW:GN OrderedLocusNames=Rmet_0978; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->261|Y978_RALME|e-151|100.0|261/261| RP:PFM:NREP 1 RP:PFM:REP 1->248|PF03883|2e-73|55.6|239/239|DUF328| HM:PFM:NREP 1 HM:PFM:REP 1->248|PF03883|1.6e-98|55.3|237/237|DUF328| OP:NHOMO 377 OP:NHOMOORG 373 OP:PATTERN -------------------------------------------------------------------- -----1--111-------------------------------------------------11------------------11------1111-111---111111-----------------------------------------11----------------------------------------------------------------------------------------------------------1111111111111111-11------111----11111111111111-------------1---1-111-----1-------1-1-1---1111--11-11--11-------------11---1111--------------------------------------------------------1-111-1111111----------------------------1-11-11-1-11--------1--111111111111-111111111111111111111111111111111111111----111111111---111--1-1------------------------------------------------------111111111111111111111111111111-------------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1------1111-1111111111-1111111121111111111111111111111111111111111111111111111111111----------------1-----------------1----------------1-1------------------- ------1-----------------------------------------------------------------------------------------------------2----------------------------------------------------------------2----12111---------111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 260-262| PSIPRED cEEEEccHHHccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHcHHHHHcccHHHccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHccHHHHcccEEEEEEEEcccccEEEEHHHHHHHHHHHHHHHHHcccccHHHHHHccccccEEcHHHcccccEEEEEEccc //