[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07889.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   24->53 PF05836 * Chorion_S16 0.00047 26.7 30/138  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07889.1 GT:GENE ABF07889.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1094827..1095018) GB:FROM 1094827 GB:TO 1095018 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF07889.1 GB:DB_XREF GI:93353800 LENGTH 63 SQ:AASEQ MDHFGASFGRFAMHKLPVVTLCLIAALSAMTVFICLSDTVAPRDTEYGSGKAVFKHYLVQYVR GT:EXON 1|1-63:0| TM:NTM 1 TM:REGION 16->38| HM:PFM:NREP 1 HM:PFM:REP 24->53|PF05836|0.00047|26.7|30/138|Chorion_S16| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHc //