[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07894.1
DDBJ      :             protein of unknown function DUF6, transmembrane
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:312 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  52->153 1s7bA_ f.39.1.1 * 1.1e-13 33.0 %
:HMM:SCOP  200->304 1s7bA_ f.39.1.1 * 6.3e-15 33.3 %
:HMM:PFM   29->149 PF00892 * EamA 4.6e-19 25.8 120/126  
:HMM:PFM   168->296 PF00892 * EamA 2.8e-23 37.1 124/126  
:BLT:SWISS 209->281 YCBK_BACSU 5e-04 31.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07894.1 GT:GENE ABF07894.1 GT:PRODUCT protein of unknown function DUF6, transmembrane GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1098321..1099259 GB:FROM 1098321 GB:TO 1099259 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF6, transmembrane GB:PROTEIN_ID ABF07894.1 GB:DB_XREF GI:93353805 InterPro:IPR000620 LENGTH 312 SQ:AASEQ MTASATGTLGHARDKLAGVLLIALSASAFGAMAIFARFAYAAGADVYGLLAVRFLLAAIAMGFVMRARGISLPPWRRVLALAAMGGIGYVSQSYCFFTALNYAQASLVALLLYLYPLFVTILAAVFLKEHLTTSTVIALVLCSVGAGLTVGGGEGSSLGIALGVAAAVIYSIYIVVGARVTAGVNAIATTTVICTAAALVYVTLGLLRAGAGVPPQFPASAGGWLALVAIALVSTVLAILTFFAGLQRLGASKASMLSTLEPVVTVVLAAVLLGEHIGPTQAVGGGLILAGVLWLTRRASGTPPLKGSDERN GT:EXON 1|1-312:0| BL:SWS:NREP 1 BL:SWS:REP 209->281|YCBK_BACSU|5e-04|31.0|71/100| TM:NTM 8 TM:REGION 16->38| TM:REGION 45->66| TM:REGION 101->123| TM:REGION 129->150| TM:REGION 157->179| TM:REGION 188->210| TM:REGION 222->244| TM:REGION 267->289| SEG 30->44|gamaifarfayaaga| SEG 102->117|yaqaslvalllylypl| SEG 143->163|svgagltvgggegsslgialg| SEG 186->198|aiatttvictaaa| SEG 263->273|vvtvvlaavll| SEG 282->295|avggglilagvlwl| HM:PFM:NREP 2 HM:PFM:REP 29->149|PF00892|4.6e-19|25.8|120/126|EamA| HM:PFM:REP 168->296|PF00892|2.8e-23|37.1|124/126|EamA| HM:SCP:REP 52->153|1s7bA_|1.1e-13|33.0|100/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 200->304|1s7bA_|6.3e-15|33.3|105/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 35 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------1--------------------------------------1-------------------------------------------------------------------------------------------------------------------------------1----1--------------------------------------------------------------------------------------------------------------------------------------------111111-111111--11111111-1111--111------------------------------------------------1-1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,6-6,300-313| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccEEccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccc //