[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07898.1
DDBJ      :             cyclohexanone monooxygenase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  165/915 : Eukaryota  139/199 : Viruses  0/175   --->[See Alignment]
c.3.1c.4.1
:505 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->220 1w4xA PDBj 2e-28 35.3 %
:RPS:PDB   12->225 2bk4B PDBj 9e-18 12.6 %
:RPS:PDB   270->399 2c10B PDBj 2e-07 13.2 %
:RPS:SCOP  10->175 1i8tA1  c.4.1.3 * 3e-16 12.2 %
:RPS:SCOP  155->350 1w4xA2  c.3.1.5 * 2e-14 19.5 %
:HMM:SCOP  5->392 1ltxR1 c.3.1.3 * 1.6e-54 28.4 %
:RPS:PFM   13->223 PF00743 * FMO-like 6e-37 41.9 %
:HMM:PFM   86->227 PF00743 * FMO-like 3.4e-18 26.4 140/532  
:HMM:PFM   185->356 PF07992 * Pyr_redox_2 0.00024 21.5 93/202  
:HMM:PFM   8->50 PF01946 * Thi4 1.4e-07 46.3 41/230  
:BLT:SWISS 13->423 HAPMO_PSEFL 1e-33 29.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07898.1 GT:GENE ABF07898.1 GT:PRODUCT cyclohexanone monooxygenase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1101744..1103261) GB:FROM 1101744 GB:TO 1103261 GB:DIRECTION - GB:PRODUCT cyclohexanone monooxygenase GB:PROTEIN_ID ABF07898.1 GB:DB_XREF GI:93353809 InterPro:IPR001100 InterPro:IPR013027 LENGTH 505 SQ:AASEQ MTAPTSDDAVLDVLIVGAGLSGIGAARQLQDRCPGKRYAILEARQAMGGTWDLFRYPGIRSDSDMYTLGYRFKPWRGAKAIADGPSILSYIRETADEAGITKHIRYGHKVVSAAWDSRSACWTIEAERTADGSRVRLRAHFLYVCAGYYSYAEGHRPTFPGEENFRGRMVHPQFWDPSIDYAGKRVVVIGSGATAVTLVPSMSQTAAHVTMLQRSPTYIVTRPGQDAIAHKLRRMLPEGLAYAATRWKNVLLGMFFFQLARRKPEKVKARMIGMAAEQLAPGYDVDTHFTPRYKPWDQRVCLVPDGDLFREIREGRASIVTDTIERFTEDGIVLASGQTLPADIVVMATGLKLNMLGDIVVTVDGVPRRPAEAMAYKGMMLSDVPNLVLAFGYTNASWTLKADLTAEYVCRLLRYMDRHGYRSAVPHVDPTVQTMPFLDFSSGYVQRAASVLPRQGDRRPWRVYQNYFMDMMTIRHGRIADGVLQFDRQGAATLPQEDALAEVQS GT:EXON 1|1-505:0| BL:SWS:NREP 1 BL:SWS:REP 13->423|HAPMO_PSEFL|1e-33|29.3|392/640| BL:PDB:NREP 1 BL:PDB:REP 11->220|1w4xA|2e-28|35.3|201/533| RP:PDB:NREP 2 RP:PDB:REP 12->225|2bk4B|9e-18|12.6|207/494| RP:PDB:REP 270->399|2c10B|2e-07|13.2|129/707| RP:PFM:NREP 1 RP:PFM:REP 13->223|PF00743|6e-37|41.9|203/247|FMO-like| HM:PFM:NREP 3 HM:PFM:REP 86->227|PF00743|3.4e-18|26.4|140/532|FMO-like| HM:PFM:REP 185->356|PF07992|0.00024|21.5|93/202|Pyr_redox_2| HM:PFM:REP 8->50|PF01946|1.4e-07|46.3|41/230|Thi4| GO:PFM:NREP 4 GO:PFM GO:0004499|"GO:flavin-containing monooxygenase activity"|PF00743|IPR000960| GO:PFM GO:0050660|"GO:FAD binding"|PF00743|IPR000960| GO:PFM GO:0050661|"GO:NADP or NADPH binding"|PF00743|IPR000960| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00743|IPR000960| RP:SCP:NREP 2 RP:SCP:REP 10->175|1i8tA1|3e-16|12.2|164/298|c.4.1.3| RP:SCP:REP 155->350|1w4xA2|2e-14|19.5|195/235|c.3.1.5| HM:SCP:REP 5->392|1ltxR1|1.6e-54|28.4|373/501|c.3.1.3|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 1623 OP:NHOMOORG 304 OP:PATTERN -------------------------------------------------------------------- ----41-1--11--OED88-8J11HF888888IKIKHAPF-1-22---1------1-2--113-4333322-------------------------1-----------1------------------------------11---1----1--------------------1--------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3447-----1-A43---11212------------11111211-2A--111--1--------512--11111-1--------2-----1------------------------------12A41-211--3233333222233212222-29362434--43--A-1---1-------------------1-1-------------------------------12--------------------------------13-----1------1-------------------------------------------------------------------21-----------------------------------------------------71-----------------6646624-11--3324-212411------------------------------------------------11----------------------------------------------------- --------------2OMQCL9ECRLSO663556876999A5AB9775B5EDUYXABG78756912----1--2-2------33261---4C6M253233241553--1F-B6383281-2--61862419H5-75521114-32333221421323235--2-6----24-33-2131-------6755E22------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 496 STR:RPRED 98.2 SQ:SECSTR ccccccccccEcEEEEcccHHHHHHHHHHHHTTcTccEEEEcccccccTTccEEEETTTEEEEccccEEcTTcHHHHHHHHHTTccEEEcccccEEEEEETTEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHTTccTTcGGGcTTHHHHHTccHHHHHHHHcccHHHHHHHHHHHHHHHcccTTTccHHHHHHHHHTTTcHHHHHccTTcTTcEEETTHHHHHHHHHHGGGEEETccEEEEEcccccEEEEETTccEEEEHHTTccccccEEEEEEEccccGGGGGTEEEEEEEccTTccccEEEEcccTTccccEEEEEEETHHHHHHTTccHHHHHHHHHHHHHHHHTcGGGccccccccTTHHHHHGGGTTcccTTEEEccGGGcccccHHHHHHHHHHHHHHHHTTcccGGGccccTcccccccccccccccHHHHHcccHHccccEEEEEEccEEcTTTTTcTTcHHHHHHHHHHHcTTcHHHH######### DISOP:02AL 1-8,502-502,505-506| PSIPRED cccccccccEEEEEEEcccHHHHHHHHHHHHHcccccEEEEEccccccccEEEEccccccccccHHHccccccccccccccccHHHHHHHHHHHHHHccccccEEEccEEEEEEEcccccEEEEEEEEcccccEEEEEEcEEEEEEccccccccccccccccccccEEEEEEcccccHHHHccccEEEEcccHHHHHHHHHHHHccccEEEEEEcccEEEEccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHccccccccccccEEEcccHHHHHHHHcccEEEcccccEEcccEEEEccccEEEccEEEEccccccccccccccccccEEccccccEEEccEEccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHcccHHHHHHHHccccEEcccccEEccccccccHHHccccccccccEEEEccccccccccHHHHHHcc //