[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07908.1
DDBJ      :             protein tyrosine phosphatase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  412/915 : Eukaryota  149/199 : Viruses  0/175   --->[See Alignment]
c.44.1
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->156 3js5A PDBj 8e-27 38.0 %
:RPS:PDB   1->155 1c0eA PDBj 9e-35 32.9 %
:RPS:SCOP  1->155 1c0eA  c.44.1.1 * 1e-39 32.9 %
:HMM:SCOP  1->155 1d1qA_ c.44.1.1 * 5.4e-47 50.0 %
:RPS:PFM   4->153 PF01451 * LMWPc 3e-23 44.7 %
:HMM:PFM   5->149 PF01451 * LMWPc 1.6e-35 43.7 135/140  
:BLT:SWISS 6->158 Y328_SYNY3 5e-30 41.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07908.1 GT:GENE ABF07908.1 GT:PRODUCT protein tyrosine phosphatase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1112013..1112492 GB:FROM 1112013 GB:TO 1112492 GB:DIRECTION + GB:PRODUCT protein tyrosine phosphatase GB:PROTEIN_ID ABF07908.1 GB:DB_XREF GI:93353819 InterPro:IPR000106 LENGTH 159 SQ:AASEQ MKKYAILMCCMGNICRSPTAEGVLRAKLEAAGLADLVELDSAGTHDYHVGRAPDARSQRHALRRGYDLSALRARQVVVADFSRFDLVLAMDQANLSALHALHADAGADKLRLLMSFATQHNAEEVPDPYYGEGDGFERVLDYIEDACDGVIEMLRKRLT GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 6->158|Y328_SYNY3|5e-30|41.4|152/157| SEG 93->110|anlsalhalhadagadkl| BL:PDB:NREP 1 BL:PDB:REP 6->156|3js5A|8e-27|38.0|150/156| RP:PDB:NREP 1 RP:PDB:REP 1->155|1c0eA|9e-35|32.9|152/154| RP:PFM:NREP 1 RP:PFM:REP 4->153|PF01451|3e-23|44.7|141/141|LMWPc| HM:PFM:NREP 1 HM:PFM:REP 5->149|PF01451|1.6e-35|43.7|135/140|LMWPc| GO:PFM:NREP 2 GO:PFM GO:0004725|"GO:protein tyrosine phosphatase activity"|PF01451|IPR017867| GO:PFM GO:0006470|"GO:protein amino acid dephosphorylation"|PF01451|IPR017867| RP:SCP:NREP 1 RP:SCP:REP 1->155|1c0eA|1e-39|32.9|152/154|c.44.1.1| HM:SCP:REP 1->155|1d1qA_|5.4e-47|50.0|154/0|c.44.1.1|1/1|Phosphotyrosine protein phosphatases I| OP:NHOMO 613 OP:NHOMOORG 561 OP:PATTERN -------------------------------------------------------------------- ----111111111-11111-11--111111111---1-111--11111111-11--11----11-1111-11---1111-111-----1111-111---11111111-11--------------1111111---1111111---1-11111111111111111111111111111111111111--11---111111111111111111-11111111111-1--11111111-1111111111111-111111-11--1-111--11--------------1---------------------------------------------------------------1-------------------------1----11------11-------------11--11111-11-1111-11--111-11111-----1-11--1111-11---------11-1111------------------------------11111111111111121111111111111112111-11-----111--1--22---21---1111111111111111-----------------------11-1----1---------1-1--------1--1-----1111-11-111111111111111-1-1---1111--------------------------------------------------------------------------------------------1----------1111----1-------11111111111111111111111111111---1111111111---12222211111111111111111111---111111------------------------------------------------1 ----11-----1111111--111--1-111111111111111111-1111111111111111-11111-1111111111-1111--11-12111-1-1----1111-1-1112-1321111-1121121343-2221-1--1152-1-1-11241121122--111-6224111-111-----112112111--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 158 STR:RPRED 99.4 SQ:SECSTR ccEEEEEEEEcccccHHHHHHHHHHHHHHHTTcGGGEEEEEEEcccTTTTccccHHHHHHHHHTTccccccccccccTTHHHHccEEEEccHHHHHHHHTTccTTcccEEEEGGGGcTTcccccccccTTccHHHHHHHHHHHHHHHHHHHTTccTHT# DISOP:02AL 1-1| PSIPRED ccccEEEEEEcccccccHHHHHHHHHHHHHcccccEEEEEEcccccccccccccHHHHHHHHHccccHHccccccccHHHHHHccEEEEEccccHHHHHHHHHcccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHc //