[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07913.1
DDBJ      :             iron-sulfur cluster assembly protein IscA
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  591/915 : Eukaryota  175/199 : Viruses  0/175   --->[See Alignment]
b.124.1
:113 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->113 2d2aA PDBj 4e-21 41.0 %
:RPS:PDB   1->113 2apnA PDBj 1e-30 29.2 %
:RPS:SCOP  9->103 1r94A  b.124.1.1 * 1e-26 52.6 %
:HMM:SCOP  7->103 1r94A_ b.124.1.1 * 1.1e-31 50.5 %
:RPS:PFM   9->99 PF01521 * Fe-S_biosyn 1e-15 39.6 %
:HMM:PFM   9->99 PF01521 * Fe-S_biosyn 4e-33 48.4 91/91  
:BLT:SWISS 9->113 ISCA_XENNE 6e-32 69.5 %
:PROS 94->111|PS01152|HESB
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07913.1 GT:GENE ABF07913.1 GT:PRODUCT iron-sulfur cluster assembly protein IscA GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1117060..1117401 GB:FROM 1117060 GB:TO 1117401 GB:DIRECTION + GB:PRODUCT iron-sulfur cluster assembly protein IscA GB:PROTEIN_ID ABF07913.1 GB:DB_XREF GI:93353824 InterPro:IPR000361 InterPro:IPR011302 LENGTH 113 SQ:AASEQ MFDSKAKMISMTEKAAKHVARYLERRGKGVGLRVGVKTTGCSGLAYKLEYVDEVLPEDQVFETHGIKVIVDPKSLPYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV GT:EXON 1|1-113:0| BL:SWS:NREP 1 BL:SWS:REP 9->113|ISCA_XENNE|6e-32|69.5|105/107| PROS 94->111|PS01152|HESB|PDOC00887| SEG 25->40|rrgkgvglrvgvkttg| BL:PDB:NREP 1 BL:PDB:REP 9->113|2d2aA|4e-21|41.0|105/114| RP:PDB:NREP 1 RP:PDB:REP 1->113|2apnA|1e-30|29.2|113/114| RP:PFM:NREP 1 RP:PFM:REP 9->99|PF01521|1e-15|39.6|91/92|Fe-S_biosyn| HM:PFM:NREP 1 HM:PFM:REP 9->99|PF01521|4e-33|48.4|91/91|Fe-S_biosyn| RP:SCP:NREP 1 RP:SCP:REP 9->103|1r94A|1e-26|52.6|95/97|b.124.1.1| HM:SCP:REP 7->103|1r94A_|1.1e-31|50.5|97/97|b.124.1.1|1/1|HesB-like domain| OP:NHOMO 1358 OP:NHOMOORG 773 OP:PATTERN ------------------------1--11-11----------------------------------11 121111111111-111111-11111111111111111111111111-1111111111111---1111---1-----------112111-----------1-1111111-1--------------1---------1-11111---11223333211111111111212433311111111111111111---111--------1------1-1111---1111-11------211111111111111-111111--------------------------------------------------------------------------------------------------1-----------------------1211121121232332223333222222222222-22222222232212223332222232222222333322222222222111-2213-1111111111122221221222221111211122222222222222222222112222222332221221113111113121111312122211111112222331-----------------------222221---------------------------222211112221222222222222222222222--122211----33232323333333333-333333333333322332333333333333333333333333333323333213333333333332212111111111322122222222222212221111111222312222222222222322222222222222222222222232222222222222222213-----------------------------------------------------32- 1-----1-1---2221111111111111112--111-11111111111111111-11-1111111111-1211111111111111111--211111111111-332-1213122321-22222232121362-214221121222121-121-1131212122211-114312311222S1111273551322221221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 100.0 SQ:SECSTR cccccccccEEccHHHHHHHHHHHHHTccccEEEEccccccccccccEEEccccccccEEEEccccEEEEcHHHHHHHTTcEEEEEccccccEEEEEcHHHHccccccccccc DISOP:02AL 1-4| PSIPRED ccccccccccccHHHHHHHHHHHHHHccccEEEEEEEEccccccEEEcccccccccccEEEEEccEEEEEcHHHHHHHcccEEEEEEcccccEEEEEcccccccccccccccc //