[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07917.1
DDBJ      :             protein of unknown function DUF528
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  213/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.159.5
:64 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->52 1uj8A PDBj 2e-15 55.8 %
:RPS:PDB   1->52 2bztA PDBj 8e-16 55.8 %
:RPS:SCOP  1->52 1uj8A1  a.159.5.1 * 1e-17 55.8 %
:HMM:SCOP  1->63 1uj8A1 a.159.5.1 * 4.2e-26 66.7 %
:RPS:PFM   1->52 PF04384 * DUF528 3e-14 71.2 %
:HMM:PFM   1->64 PF04384 * DUF528 4.5e-36 71.9 64/64  
:BLT:SWISS 1->52 ISCX_SHIFL 2e-15 55.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07917.1 GT:GENE ABF07917.1 GT:PRODUCT protein of unknown function DUF528 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1120262..1120456 GB:FROM 1120262 GB:TO 1120456 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF528 GB:PROTEIN_ID ABF07917.1 GB:DB_XREF GI:93353828 InterPro:IPR007479 LENGTH 64 SQ:AASEQ MKWTDTYDIAAALYDKFPEVDPLTVRFTQLRQWVLELDDFSDLPERSGEKILEAIQAAWIEEAQ GT:EXON 1|1-64:0| BL:SWS:NREP 1 BL:SWS:REP 1->52|ISCX_SHIFL|2e-15|55.8|52/66| SEG 53->63|eaiqaawieea| BL:PDB:NREP 1 BL:PDB:REP 1->52|1uj8A|2e-15|55.8|52/73| RP:PDB:NREP 1 RP:PDB:REP 1->52|2bztA|8e-16|55.8|52/66| RP:PFM:NREP 1 RP:PFM:REP 1->52|PF04384|3e-14|71.2|52/64|DUF528| HM:PFM:NREP 1 HM:PFM:REP 1->64|PF04384|4.5e-36|71.9|64/64|DUF528| GO:PFM:NREP 1 GO:PFM GO:0016226|"GO:iron-sulfur cluster assembly"|PF04384|IPR007479| RP:SCP:NREP 1 RP:SCP:REP 1->52|1uj8A1|1e-17|55.8|52/64|a.159.5.1| HM:SCP:REP 1->63|1uj8A1|4.2e-26|66.7|63/0|a.159.5.1|1/1|IscX-like| OP:NHOMO 214 OP:NHOMOORG 213 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------111111111-11111111111111111111111--111-----------1111111111121111-----1------------------------1111-----------------------------11------1---1-11111-111111111111------1------111111-1111111-11-111111111111111111111111111111111111111111111111111--111111111111---1---------1----111111-11111---11111111111-111111--111111111----------11111111111111---------------11-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 52 STR:RPRED 81.2 SQ:SECSTR cccccHHHHHHHHHHHcTTccTTTccHHHHHHHHHHccccccccccccHHHH############ DISOP:02AL 63-65| PSIPRED cccHHHHHHHHHHHHHcccccccEEEHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcc //