[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07930.1
DDBJ      :             transcriptional regulator, RpiR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  439/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
a.4.1c.80.1
:338 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->66 2o3fA PDBj 2e-05 40.7 %
:BLT:PDB   128->237 3fxaC PDBj 2e-07 22.7 %
:RPS:PDB   12->257 2cvpA PDBj 4e-37 13.0 %
:RPS:SCOP  3->76 2o3fA1  a.4.1.20 * 9e-20 32.4 %
:RPS:SCOP  91->266 1jeoA  c.80.1.3 * 5e-34 18.1 %
:HMM:SCOP  87->275 1j5xA_ c.80.1.1 * 9.1e-39 30.1 %
:RPS:PFM   3->72 PF01418 * HTH_6 4e-15 47.1 %
:RPS:PFM   123->222 PF01380 * SIS 5e-11 41.0 %
:HMM:PFM   4->104 PF01418 * HTH_6 1.1e-25 32.7 101/107  
:HMM:PFM   123->249 PF01380 * SIS 6.7e-22 33.3 126/131  
:BLT:SWISS 3->282 GLK_BURS3 4e-59 44.3 %
:PROS 35->53|PS00356|HTH_LACI_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07930.1 GT:GENE ABF07930.1 GT:PRODUCT transcriptional regulator, RpiR family GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1135746..1136762) GB:FROM 1135746 GB:TO 1136762 GB:DIRECTION - GB:PRODUCT transcriptional regulator, RpiR family GB:PROTEIN_ID ABF07930.1 GB:DB_XREF GI:93353841 InterPro:IPR000281 InterPro:IPR000843 InterPro:IPR001347 LENGTH 338 SQ:AASEQ MRDRILAVYDSLRPSERRLADYVARHGASVIRLTMPELADRAGVSQPTIARFCAALGYDGFKEFKLQFAQNVGGGTPFVHQDVEADDRPADIAGKVFDRTIATLMSVRNALSADQIEHGIRLLAGARRIEFYGCGNSGIVALDIQHKFFRLGIPTTAYSDPHVFSMSAALLRPGDVAVLVSNSGRTWDMLTAATLARSSGASVLALTHSGSPLARLADVCVFSDVEEDSEVYTPMTSRICHLVLGDVLAAGVALDRADSVAAGLQRAKAHLRERRIAGADPAPLGKTPAAASATTASEATSQSIKPSRAARRPTKSDSPANKTTKPAAHRGAGGASRQ GT:EXON 1|1-338:0| BL:SWS:NREP 1 BL:SWS:REP 3->282|GLK_BURS3|4e-59|44.3|280/642| PROS 35->53|PS00356|HTH_LACI_1|PDOC00366| SEG 287->303|tpaaasattaseatsqs| BL:PDB:NREP 2 BL:PDB:REP 6->66|2o3fA|2e-05|40.7|59/75| BL:PDB:REP 128->237|3fxaC|2e-07|22.7|110/187| RP:PDB:NREP 1 RP:PDB:REP 12->257|2cvpA|4e-37|13.0|239/557| RP:PFM:NREP 2 RP:PFM:REP 3->72|PF01418|4e-15|47.1|70/102|HTH_6| RP:PFM:REP 123->222|PF01380|5e-11|41.0|100/131|SIS| HM:PFM:NREP 2 HM:PFM:REP 4->104|PF01418|1.1e-25|32.7|101/107|HTH_6| HM:PFM:REP 123->249|PF01380|6.7e-22|33.3|126/131|SIS| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01418|IPR000281| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01418|IPR000281| GO:PFM GO:0005529|"GO:sugar binding"|PF01380|IPR001347| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01380|IPR001347| RP:SCP:NREP 2 RP:SCP:REP 3->76|2o3fA1|9e-20|32.4|74/83|a.4.1.20| RP:SCP:REP 91->266|1jeoA|5e-34|18.1|171/177|c.80.1.3| HM:SCP:REP 87->275|1j5xA_|9.1e-39|30.1|186/329|c.80.1.1|1/1|SIS domain| OP:NHOMO 1052 OP:NHOMOORG 445 OP:PATTERN -------------------------------------------------------------------- ----1--------------------1-------------1-13-16---2-11-1--3--31-111212211---2111----------------------------------------------------------------------1---------------------------------12---11---21111122221212223322422122-211132332223113333333333333331122821-54--31344--452261215331111111111111111121111111111111111112---222211-19333232212--4---1122--1---1------------1-3---11-------------1-1--------22222221224--------113--3334111111421-11--13-----11--------------2--------------------------------1-----1-14333343444432444444344443443--4442-21111333611-----1-1111111-----------------------------------------------------------------21411-1-2-11211111111111111111-------------75133514334444433-3444546344343444445676221254533333333434334733433331-655455555555---------------331223-21111112132----------3122223333232322333----------3334333332224411---------------1----------------1------1---1---------------321-24222--- --------------------------------------------------------------------------------------------------------------------------------------------------------------2----1------1--1------------1-------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 286 STR:RPRED 84.6 SQ:SECSTR HHHHHHHHHcHEccccEEEEEcTTccccHHHHHHHHHHHHHTTHHHHHHHHHTTccccTTTTccccHHHHHHHTTTHTcTTccccEETTEEcHHHHHHHHHHHHHHHHHHHTTccccTTcccccEEEEEccGGGTHHHHHHHHHTGGGGTTccEEEEccHHHHHHHHTTccTTcEEEEEEccccccHHHHHHHHHHHHHHHHHHccGGGGGTEEEEEccHHHHHHHTccGGGEGGGcTTTGGGHHHHHHHcHHHHHHHHHHHHHHHHHHHTccccGGGcHHHHHHH#################################################### DISOP:02AL 266-281,293-339| PSIPRED cHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHccHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHcccEEEEEEccccHHHHHccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHccccHHHHccccccccccccccccHHHccccccccc //