[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07940.1
DDBJ      :             protein of unknown function DUF1330
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  101/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:96 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->96 2fiuA PDBj 4e-12 42.4 %
:RPS:PDB   7->96 3dcaA PDBj 4e-19 16.9 %
:RPS:SCOP  2->96 2fiuA1  d.58.4.16 * 2e-27 41.5 %
:HMM:SCOP  1->96 2fiuA1 d.58.4.16 * 4.6e-31 45.7 %
:RPS:PFM   16->78 PF07045 * DUF1330 1e-09 50.8 %
:HMM:PFM   15->79 PF07045 * DUF1330 6.4e-28 50.8 65/65  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07940.1 GT:GENE ABF07940.1 GT:PRODUCT protein of unknown function DUF1330 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1148016..1148306 GB:FROM 1148016 GB:TO 1148306 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF1330 GB:PROTEIN_ID ABF07940.1 GB:DB_XREF GI:93353851 InterPro:IPR010753 LENGTH 96 SQ:AASEQ MAAGYIIAYVDVTDPQQYEQYKVLSTKAMQAHGAEVLVRGGQTERLEGDWGPTRVVVLKFQSYEAARAFHASEEYLAARKSREHAAKMNMIVVEGI GT:EXON 1|1-96:0| BL:PDB:NREP 1 BL:PDB:REP 2->96|2fiuA|4e-12|42.4|92/93| RP:PDB:NREP 1 RP:PDB:REP 7->96|3dcaA|4e-19|16.9|89/127| RP:PFM:NREP 1 RP:PFM:REP 16->78|PF07045|1e-09|50.8|63/65|DUF1330| HM:PFM:NREP 1 HM:PFM:REP 15->79|PF07045|6.4e-28|50.8|65/65|DUF1330| RP:SCP:NREP 1 RP:SCP:REP 2->96|2fiuA1|2e-27|41.5|94/95|d.58.4.16| HM:SCP:REP 1->96|2fiuA1|4.6e-31|45.7|92/0|d.58.4.16|1/1|Dimeric alpha+beta barrel| OP:NHOMO 117 OP:NHOMOORG 102 OP:PATTERN -------------------------------------------------------------------- ---------------11----1---2------1-----1----2-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------1-1---12---11111111111------1-112--111111211111-1----321111221-------------1------------------------------------1-111------121111111-1111-----1111--111--1-11-3-1---2-----------------1-----------------------------1--------------------------------1-----------------------------------------1--------------------------------------------------------------------------------------------------1---------------111-1-1----1----1-111-111-211------------------------------------------------------------------------------------------------- --------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 99.0 SQ:SECSTR #ccEEEcccccccHHHHHHHHHHHHHHHHHHHTcEEEEEEccccccccTTcccEEEEEEEccHHHHHHHHTcHHHHHHHHHHHHHEEEEEEEEccc PSIPRED cccEEEEEEEEEccHHHHHHHHHHHHHHHHHcccEEEEEcccEEEEcccccccEEEEEEEccHHHHHHHHccHHHHHHHHHHHcccEEEEEEEEcc //