[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07943.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:131 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07943.1 GT:GENE ABF07943.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1150306..1150701) GB:FROM 1150306 GB:TO 1150701 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF07943.1 GB:DB_XREF GI:93353854 LENGTH 131 SQ:AASEQ MTKTYRSRALPWLVIAMAAMITGCAAPVPRDMYGSPATARLEPGSTPPAPLTDEEKQQLTELNQQVLREQEHVIASQQQAEAWARAAYAYPSTNWNLYYGGWGGGHWGGGVGISSPGWGWGGYPYGSPYWW GT:EXON 1|1-131:0| TM:NTM 1 TM:REGION 8->30| SEG 75->89|asqqqaeawaraaya| SEG 98->130|yyggwggghwgggvgisspgwgwggypygspyw| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccccHHHHHHHHHHHHHHHHHHccccccccccccccccEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEcccccccccccccccccccccccccccccccc //