Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07957.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:94 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07957.1 GT:GENE ABF07957.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1163438..1163722) GB:FROM 1163438 GB:TO 1163722 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF07957.1 GB:DB_XREF GI:93353868 LENGTH 94 SQ:AASEQ MLWPLAVRKKKLLLPPLTRLLRLLLLRLKLRLRLLLRLLTLRLRLLLRLTLRLRLLTLRLRLPSSNRIRPIKKPTFGSAFFISRIFLTPHSRGR GT:EXON 1|1-94:0| SEG 8->63|rkkklllppltrllrllllrlklrlrlllrlltlrlrlllrltlrlrlltlrlrlp| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 91-95| PSIPRED ccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEccccccccccccccccHHHHHHHHHcccccccc //