[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07997.1
DDBJ      :             HpcH/HpaI aldolase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  251/915 : Eukaryota  51/199 : Viruses  0/175   --->[See Alignment]
c.1.12
:251 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->241 1dxeA PDBj 1e-18 28.1 %
:RPS:PDB   7->248 1dxeA PDBj 5e-17 25.6 %
:RPS:SCOP  1->248 1dxeA  c.1.12.5 * 6e-52 26.4 %
:HMM:SCOP  11->249 1izcA_ c.1.12.5 * 1.7e-52 43.6 %
:RPS:PFM   14->201 PF03328 * HpcH_HpaI 4e-11 43.0 %
:HMM:PFM   15->235 PF03328 * HpcH_HpaI 2e-30 35.4 198/221  
:BLT:SWISS 14->241 GARL_SHIDS 3e-19 28.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07997.1 GT:GENE ABF07997.1 GT:PRODUCT HpcH/HpaI aldolase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1210197..1210952) GB:FROM 1210197 GB:TO 1210952 GB:DIRECTION - GB:PRODUCT HpcH/HpaI aldolase GB:PROTEIN_ID ABF07997.1 GB:DB_XREF GI:93353908 InterPro:IPR005000 LENGTH 251 SQ:AASEQ MKQRLLTPGSEPIVGLFCSTPAPLTVELIAAAGYDFAVIDLEHTLIDGALLGAMLLAARASGIAPLVRVAALHQVAPALDAGAQGIVFPRITGAARASEAVAYCHHTCGIPAGKRGLNATWHSGYGRDDLCEAAEDAARHTLVVAMIEDAAGLRNADDIAAQRGVDVLLEGAADLSQSLGVPWQTRHPHVRDAVDTIAAAALRHDKHFCALPRTPADAAAWRARGTRMMVLGDDRGIARRAMAAHRQACIA GT:EXON 1|1-251:0| BL:SWS:NREP 1 BL:SWS:REP 14->241|GARL_SHIDS|3e-19|28.6|224/256| SEG 45->62|lidgallgamllaarasg| BL:PDB:NREP 1 BL:PDB:REP 14->241|1dxeA|1e-18|28.1|224/253| RP:PDB:NREP 1 RP:PDB:REP 7->248|1dxeA|5e-17|25.6|238/253| RP:PFM:NREP 1 RP:PFM:REP 14->201|PF03328|4e-11|43.0|165/219|HpcH_HpaI| HM:PFM:NREP 1 HM:PFM:REP 15->235|PF03328|2e-30|35.4|198/221|HpcH_HpaI| GO:PFM:NREP 2 GO:PFM GO:0006725|"GO:cellular aromatic compound metabolic process"|PF03328|IPR005000| GO:PFM GO:0016830|"GO:carbon-carbon lyase activity"|PF03328|IPR005000| RP:SCP:NREP 1 RP:SCP:REP 1->248|1dxeA|6e-52|26.4|242/253|c.1.12.5| HM:SCP:REP 11->249|1izcA_|1.7e-52|43.6|236/0|c.1.12.5|1/1|Phosphoenolpyruvate/pyruvate domain| OP:NHOMO 500 OP:NHOMOORG 304 OP:PATTERN ------------------------------1------------------1------------------ --2-1----------2---------1----------1114---1--------111-1---------1----------------------------------------2--------------------1-------11111----1------------------------1-------------1-------------------------------------------------11111111111111----------------------------------------------------------------------------1-------------------------------11------------------1--------1-111---11-1-112111112-----1--311221-11111-61-1111----32221211111-1111112----1---------------------------------13--154-2211112111111134222212223-122--112122--116232---1------------111--1-------11--111-----------------------------------------------1-------------1---------1----------------1-22-1-2222221213-13221222112233323323332111-3233333333333333122111131--11111111111----------------13---2-1--------1----------3-112111-1--1----11-------------------1---1--------------------1111------------------------------------------------- --------21-----11--2221442211----1111111--111-2-1343A4112--111--1------------------------1-2111-5455-------------------------------------------------------------------------------------1--3-2-------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 249 STR:RPRED 99.2 SQ:SECSTR HHHHHHHHTTccEEEEEEccccHHHHHHHTTccccEEEEEcccccccHHHHHHHHHHTTTcccEEEEEcccccHHHHHHHTTccEEEEcccccHHHHHHHHHTTccTHHHTTcccccccccGGGGGGGTcTTHHHHHTTccEEEEEEccHHHHHTHHHHHTcTTccEEEEcHHHHHHHTTcTTcTTcHHHHHHHHHHHHHHHHTTccEEEEcccHHHHHHHHHTTccEEEEEEHHHHHHHHHHHHHHHH## DISOP:02AL 1-1,5-7,251-252| PSIPRED ccHHHHHHcccEEEEEEEccccHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccccccccccccHHHHcccccccHHHHHHHHccccEEEEEEccHHHHHHHHHHHccccccEEEEccHHHHHHcccccccccHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHHHcc //