[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08038.1
DDBJ      :             transcriptional regulator, LuxR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  70/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.6d.110.3f.55.1
:181 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   112->176 1x3uA PDBj 1e-06 36.9 %
:RPS:PDB   6->101 1d7eA PDBj 2e-09 9.4 %
:RPS:PDB   73->181 3cloA PDBj 4e-12 16.5 %
:RPS:SCOP  6->135 2axtC1  f.55.1.1 * 4e-10 6.2 %
:RPS:SCOP  124->181 1fseA  a.4.6.2 * 2e-12 36.2 %
:HMM:SCOP  7->117 1ll8A_ d.110.3.5 * 3.8e-14 17.6 %
:HMM:SCOP  102->181 1p4wA_ a.4.6.2 * 2.8e-15 28.8 %
:RPS:PFM   124->176 PF00196 * GerE 2e-07 37.7 %
:HMM:PFM   122->176 PF00196 * GerE 5.4e-18 36.4 55/58  
:HMM:PFM   5->97 PF00989 * PAS 4.6e-08 14.1 92/113  
:BLT:SWISS 37->144 TCSA_EMENI 4e-04 27.6 %
:BLT:SWISS 124->178 UHPA_SHIFL 5e-09 43.6 %
:PROS 138->165|PS00622|HTH_LUXR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08038.1 GT:GENE ABF08038.1 GT:PRODUCT transcriptional regulator, LuxR family GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1262387..1262932) GB:FROM 1262387 GB:TO 1262932 GB:DIRECTION - GB:PRODUCT transcriptional regulator, LuxR family GB:PROTEIN_ID ABF08038.1 GB:DB_XREF GI:93353949 InterPro:IPR000014 InterPro:IPR000792 LENGTH 181 SQ:AASEQ MPSIDYQTAFQLAPVGLVLSRARMIEDCNDEVCRIFGTTRDALVGESFQVLYPTADEFERTGARIVPIMNAKGMYSDERIMKRANGELFWCHVTGRALDRQDPLGSGIWTFEDLSQKRPVTAELTARERDIAAQLVEGKTSKQIGKLLAISPRTVDIYRARLMKKYGAHTAVDLVQRLVNH GT:EXON 1|1-181:0| BL:SWS:NREP 2 BL:SWS:REP 37->144|TCSA_EMENI|4e-04|27.6|98/682| BL:SWS:REP 124->178|UHPA_SHIFL|5e-09|43.6|55/196| PROS 138->165|PS00622|HTH_LUXR_1|PDOC00542| BL:PDB:NREP 1 BL:PDB:REP 112->176|1x3uA|1e-06|36.9|65/79| RP:PDB:NREP 2 RP:PDB:REP 6->101|1d7eA|2e-09|9.4|96/119| RP:PDB:REP 73->181|3cloA|4e-12|16.5|109/249| RP:PFM:NREP 1 RP:PFM:REP 124->176|PF00196|2e-07|37.7|53/57|GerE| HM:PFM:NREP 2 HM:PFM:REP 122->176|PF00196|5.4e-18|36.4|55/58|GerE| HM:PFM:REP 5->97|PF00989|4.6e-08|14.1|92/113|PAS| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 2 RP:SCP:REP 6->135|2axtC1|4e-10|6.2|128/447|f.55.1.1| RP:SCP:REP 124->181|1fseA|2e-12|36.2|58/67|a.4.6.2| HM:SCP:REP 7->117|1ll8A_|3.8e-14|17.6|108/114|d.110.3.5|1/1|PYP-like sensor domain (PAS domain)| HM:SCP:REP 102->181|1p4wA_|2.8e-15|28.8|80/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 91 OP:NHOMOORG 72 OP:PATTERN -------------------------------------------------------------------- --1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1---11--------------11-1-1-1----------------------1-----22-------------1-----------------------------------------12111121111122111111111111111--1113222221151-112----------------211-----1------------1------------1-------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------1-----1------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 176 STR:RPRED 97.2 SQ:SECSTR #####HHHHHcccccEEEEEETTcEEEEcTHHHHHHcccHHHHHHcGGGGGGGccHHHHHHHHHHHHHHHTTcEEcTTccEEEEEEEEEEccccccccccccEEEETTTEEEEcccHHHHTTcccHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccHHHHHHHHHHT DISOP:02AL 1-1,118-119| PSIPRED cccHHHHHHHHHcccEEEEEcccEEEEccHHHHHHHcccHHHHccccHHHHccccccHHHHHHHHHHHHHcccccHHHEEEEcccccEEHHHHccHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHcc //