[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08055.1
DDBJ      :             peptide methionine sulfoxide reductase
Swiss-Prot:             

Homologs  Archaea  31/68 : Bacteria  781/915 : Eukaryota  182/199 : Viruses  0/175   --->[See Alignment]
d.58.28
:243 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   57->209 3bqhA PDBj 1e-35 44.0 %
:RPS:PDB   57->235 3e0mC PDBj 1e-55 31.0 %
:RPS:SCOP  36->208 1ff3A  d.58.28.1 * 8e-59 42.4 %
:HMM:SCOP  17->226 1ff3A_ d.58.28.1 * 4.1e-64 41.8 %
:RPS:PFM   59->209 PF01625 * PMSR 2e-41 55.7 %
:HMM:PFM   59->213 PF01625 * PMSR 4e-59 53.3 152/156  
:BLT:SWISS 49->239 MSRA2_RHILO 3e-75 66.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08055.1 GT:GENE ABF08055.1 GT:PRODUCT peptide methionine sulfoxide reductase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1279575..1280306) GB:FROM 1279575 GB:TO 1280306 GB:DIRECTION - GB:PRODUCT peptide methionine sulfoxide reductase GB:PROTEIN_ID ABF08055.1 GB:DB_XREF GI:93353966 InterPro:IPR002569 LENGTH 243 SQ:AASEQ MDAMTTLQRWTRPTALKLASLAVLMVAAAMWELPAISAEAAVKIPAPAVDEKAGTSHTETAVFAGGCFWGVQGVFQHVRGVTRVTSGYSGGSASNAQYEMVGTGMTGHAESVEIRYDPTQISYGKLLQIFFSVAHNPTQLNYQGPDHGTQYRSAIFPRSPVQRSIAEAYITQLDTSKAYRAPIVTRVEDYKGFFPAENYHQDFLVKNPSYPYIVINDLPKIGNLKTMFPDVYRNDAVLVSKGG GT:EXON 1|1-243:0| BL:SWS:NREP 1 BL:SWS:REP 49->239|MSRA2_RHILO|3e-75|66.3|190/195| TM:NTM 1 TM:REGION 21->43| SEG 15->30|alklaslavlmvaaam| BL:PDB:NREP 1 BL:PDB:REP 57->209|3bqhA|1e-35|44.0|150/162| RP:PDB:NREP 1 RP:PDB:REP 57->235|3e0mC|1e-55|31.0|174/313| RP:PFM:NREP 1 RP:PFM:REP 59->209|PF01625|2e-41|55.7|149/156|PMSR| HM:PFM:NREP 1 HM:PFM:REP 59->213|PF01625|4e-59|53.3|152/156|PMSR| GO:PFM:NREP 3 GO:PFM GO:0016671|"GO:oxidoreductase activity, acting on sulfur group of donors, disulfide as acceptor"|PF01625|IPR002569| GO:PFM GO:0019538|"GO:protein metabolic process"|PF01625|IPR002569| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01625|IPR002569| RP:SCP:NREP 1 RP:SCP:REP 36->208|1ff3A|8e-59|42.4|172/211|d.58.28.1| HM:SCP:REP 17->226|1ff3A_|4.1e-64|41.8|208/0|d.58.28.1|1/1|Peptide methionine sulfoxide reductase| OP:NHOMO 1513 OP:NHOMOORG 994 OP:PATTERN ------11------1---------21113111211---1111-21111-1111-----1--1----11 132-111111111111111-11111211111111111111111111111111111111--11111111111-11111111111-----1111-111---11212241142--------------111111111111111111112-222211211222222221212223122222222222211111--111122222222222222222111122221132331111111633333323332233333333112122321-133112211111222211122222112222222222222222222222222112221111-11111111121-2--111-111111111----221----1------1221-22222-----133222122222211111111111-22122133222-2111223222331223122111112221111111113311111-----------------------------122231111122222222111122421111112231213-11111111121212112221111-111111111221111112112111111111122121111212111111111111111111111111-11211112121422433322223262222222222---2111------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---211111223212122111-1--1111111111111112321211211233111111111222122222122212222233333221111111111111111221122--------111----1-1111-11---11111-1111-11------111 ----111-21111111111111111111111111111111111111111111111111-1--31111111111111111111111111-11111-111111-1222-1D122322211111-1121111461-2141111111111111-1111111122111411-3221-1121455c3242353461687442228 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 73.7 SQ:SECSTR ########################################################cEEEEEEEcccHHHHHHHHHTcTTEEEEEEEEEccccccccTTTHHHccHTcEEEEEEEEETTTccHHHHHHHHHHHHcccccccEETTEEcGGGccEEEEccGGGHHHHHHHHHHHGHHHHHccccccEEEEcccEEEccTTTTTHHHHcTTcccccGGGGGcccccGGGGccccHHH######## DISOP:02AL 1-3,42-42,45-53,242-244| PSIPRED ccHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEEEHHHHHHHHHHcccEEEEEEEEcccccccccHHHHcccccccEEEEEEEEccccccHHHHHHHHHHHcccccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHHHHHccEEccccc //