[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08064.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:185 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   48->105 PF10099 * RskA 1.7e-05 25.5 55/175  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08064.1 GT:GENE ABF08064.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1288971..1289528 GB:FROM 1288971 GB:TO 1289528 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF08064.1 GB:DB_XREF GI:93353975 LENGTH 185 SQ:AASEQ MYSISTLSTHCTCRILIFMEDRVRDAGLASTSHWCNLKRNEAPDIRPQTEVPMLQRDAQFTSRICWFAAGLLAGALAASLCAALGMRRARQVADDDDAATAQDPRAMVRASISPESGSDMFEYRGFVVHLFWQALGRERYKAWCDIWEAGAVVQEAGGPPATYPTAAEARMAAGAWARHWVQNNG GT:EXON 1|1-185:0| SEG 68->85|aagllagalaaslcaalg| SEG 87->106|rrarqvaddddaataqdpra| SEG 155->177|eaggppatyptaaearmaagawa| HM:PFM:NREP 1 HM:PFM:REP 48->105|PF10099|1.7e-05|25.5|55/175|RskA| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,184-186| PSIPRED cccEEccccccEEEEEEEEEcHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHcccccccccHHHHHcHHHHHHHHHHHccccEEEEEEHHHccHHHHHccccccccccHHHHHHHHHHHHHHHHHccc //