[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08068.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:173 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   10->143 2a61A PDBj 5e-07 14.2 %
:RPS:SCOP  10->140 2a61A1  a.4.5.28 * 8e-07 14.5 %
:HMM:SCOP  3->139 2fbkA1 a.4.5.28 * 1.9e-09 17.5 %
:HMM:PFM   64->163 PF06252 * DUF1018 7.3e-05 24.7 89/119  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08068.1 GT:GENE ABF08068.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1295304..1295825) GB:FROM 1295304 GB:TO 1295825 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF08068.1 GB:DB_XREF GI:93353979 LENGTH 173 SQ:AASEQ MQPKALDTHEPVVLALVEAVTAWQGALEQTLGVSGLTYPKWLLLRAIRHEEFVRGKPCETAIFLDVAQSEHMLRELGDDGWLSFDADGTPRIAPASVARMKRAAQAIKALHSVSAGQFSTSERAALSSLLHRMTTTLEDHVARHIRHAAWERDEMSMVVPDELRRVAQQAIAA GT:EXON 1|1-173:0| RP:PDB:NREP 1 RP:PDB:REP 10->143|2a61A|5e-07|14.2|134/142| HM:PFM:NREP 1 HM:PFM:REP 64->163|PF06252|7.3e-05|24.7|89/119|DUF1018| RP:SCP:NREP 1 RP:SCP:REP 10->140|2a61A1|8e-07|14.5|131/139|a.4.5.28| HM:SCP:REP 3->139|2fbkA1|1.9e-09|17.5|137/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 81.5 SQ:SECSTR ##cHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHTccHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHTTc############################## DISOP:02AL 1-6,146-146,171-174| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccEEccccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccccHHHHHHHHHHHHcc //