[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08073.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.354.1
:88 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   15->87 1dmlC PDBj 6e-04 30.1 %
:RPS:SCOP  4->72 2gpiA1  d.354.1.1 * 7e-04 33.3 %
:RPS:PFM   4->80 PF07369 * DUF1488 4e-05 39.0 %
:HMM:PFM   3->80 PF07369 * DUF1488 2e-22 37.2 78/83  
:BLT:SWISS 4->72 YRDB_ECOLI 3e-06 31.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08073.1 GT:GENE ABF08073.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1301114..1301380 GB:FROM 1301114 GB:TO 1301380 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF08073.1 GB:DB_XREF GI:93353984 LENGTH 88 SQ:AASEQ MMEIKFQEQDRYDINNEGLLFHAIVDGEQVTCVVTREALWEGFSADQVLSLEEAFRAGRETIERAALVLIEQGVPQPIVVKRAHVAPV GT:EXON 1|1-88:0| BL:SWS:NREP 1 BL:SWS:REP 4->72|YRDB_ECOLI|3e-06|31.9|69/85| RP:PDB:NREP 1 RP:PDB:REP 15->87|1dmlC|6e-04|30.1|73/272| RP:PFM:NREP 1 RP:PFM:REP 4->80|PF07369|4e-05|39.0|77/81|DUF1488| HM:PFM:NREP 1 HM:PFM:REP 3->80|PF07369|2e-22|37.2|78/83|DUF1488| RP:SCP:NREP 1 RP:SCP:REP 4->72|2gpiA1|7e-04|33.3|66/90|d.354.1.1| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 73 STR:RPRED 83.0 SQ:SECSTR ##############ETTEEEEEEEETTEEEEEEEEGGGccccccEETTEETTcTTcTTTcTTEEEEEEEEEccTTccEEEEEEEEcc# DISOP:02AL 1-4| PSIPRED ccEEEccccHHHcccccEEEEEEEEcccEEEEEEEHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHHHcccccEEEEEcccccc //