[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08100.1
DDBJ      :             arginine-tRNA-protein transferase-like protein
Swiss-Prot:ATE_RALME    RecName: Full=Putative arginyl-tRNA--protein transferase;         Short=R-transferase;         Short=Arginyltransferase;         EC=2.3.2.8;

Homologs  Archaea  0/68 : Bacteria  267/915 : Eukaryota  61/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:262 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  83->248 1lrzA3 d.108.1.4 * 6.2e-17 24.7 %
:RPS:PFM   15->98 PF04376 * ATE_N 4e-18 45.2 %
:RPS:PFM   110->237 PF04377 * ATE_C 6e-25 52.9 %
:HMM:PFM   109->242 PF04377 * ATE_C 3.4e-46 42.2 128/128  
:HMM:PFM   13->96 PF04376 * ATE_N 4.7e-30 42.9 84/88  
:BLT:SWISS 1->262 ATE_RALME e-156 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08100.1 GT:GENE ABF08100.1 GT:PRODUCT arginine-tRNA-protein transferase-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1333359..1334147) GB:FROM 1333359 GB:TO 1334147 GB:DIRECTION - GB:PRODUCT arginine-tRNA-protein transferase-like protein GB:PROTEIN_ID ABF08100.1 GB:DB_XREF GI:93354011 InterPro:IPR007471 InterPro:IPR007472 LENGTH 262 SQ:AASEQ MSKLKELPLSALQFYATAPYACSYLEGRMARSQVATPAHLINADVYSRLVRAGFRRSGIFTYRPYCDECRACTPCRVLVDQFRPDRSQRRAWRDHQGLQALVAPLTYVEEHYALYLLYQSMRHAGGGMDQDSRDQYEQFLLQSRVNSRLVEFREPPGSPEAGRLRMVSMIDVLDDGLSSVYTFYDPLIVGASYGTYNILWQINQTRELGLPHLYLGYWIADSRKMAYKARFQPLQVLTGNQWHTFKAPAEASGQPAPDPALE GT:EXON 1|1-262:0| SW:ID ATE_RALME SW:DE RecName: Full=Putative arginyl-tRNA--protein transferase; Short=R-transferase; Short=Arginyltransferase; EC=2.3.2.8; SW:GN Name=ate; OrderedLocusNames=Rmet_1214; SW:KW Acyltransferase; Complete proteome; Cytoplasm; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->262|ATE_RALME|e-156|100.0|262/262| GO:SWS:NREP 3 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| RP:PFM:NREP 2 RP:PFM:REP 15->98|PF04376|4e-18|45.2|84/85|ATE_N| RP:PFM:REP 110->237|PF04377|6e-25|52.9|121/127|ATE_C| HM:PFM:NREP 2 HM:PFM:REP 109->242|PF04377|3.4e-46|42.2|128/128|ATE_C| HM:PFM:REP 13->96|PF04376|4.7e-30|42.9|84/88|ATE_N| GO:PFM:NREP 4 GO:PFM GO:0004057|"GO:arginyltransferase activity"|PF04376|IPR007471| GO:PFM GO:0016598|"GO:protein arginylation"|PF04376|IPR007471| GO:PFM GO:0004057|"GO:arginyltransferase activity"|PF04377|IPR007472| GO:PFM GO:0016598|"GO:protein arginylation"|PF04377|IPR007472| HM:SCP:REP 83->248|1lrzA3|6.2e-17|24.7|158/0|d.108.1.4|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 361 OP:NHOMOORG 328 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-----111111111111111111111111-11111111111-1111111111111111111111111111111111111111111------------------------------1111-1111111111111111111111111111111111111111111111111111121111-------111111----1-1---------------------11--1----111111-1-------11-11111111111111-1111111111111111111---1111--------------------------------------------------------------------------------------------1---------1111----------------1111111--11111111111111111111----------1111111111111111111111111111--1---1111------------------------------------------------- ----11------111--------------11--111---------1----------------1--1--------------1--1-1----1-----------111--1-1--------111-1122-1-3B2-221--111-11111---1--4----1233-1-----2-22------4-11-----1-211------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9,249-263| PSIPRED ccccccccccccEEEEcccccccccccHHHcEEEEcccccccHHHHHHHHHHHHHHcccEEEEcccccccccEEEEEcHHHccccHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccEEEEEEEccccccccEEEEEEEEEEcccccEEEEEEEccccccccccHHHHHHHHHHHHHccccEEEccEEccccccccccccccccEEEEccEEEEcccccccccccccccccc //