[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08105.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:129 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  32->88 1lliA  a.35.1.2 * 6e-04 23.1 %
:RPS:PFM   78->127 PF09722 * DUF2384 4e-08 52.0 %
:HMM:PFM   77->128 PF09722 * DUF2384 6.3e-18 42.3 52/54  
:HMM:PFM   32->57 PF01381 * HTH_3 0.00048 42.3 26/55  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08105.1 GT:GENE ABF08105.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1337372..1337761) GB:FROM 1337372 GB:TO 1337761 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF08105.1 GB:DB_XREF GI:93354016 LENGTH 129 SQ:AASEQ MQSGQIPTPDPGSAPDPGVTLTKAVMRAASFLGISQAIVASVLGISTASVSRMASGGYVLDVHRKEWEFAVLFVRLFRSLDAILGHEEQARLWLTHDNLALGGKPLELIRTTEGIVRVVHYLDATRGRI GT:EXON 1|1-129:0| RP:PFM:NREP 1 RP:PFM:REP 78->127|PF09722|4e-08|52.0|50/54|DUF2384| HM:PFM:NREP 2 HM:PFM:REP 77->128|PF09722|6.3e-18|42.3|52/54|DUF2384| HM:PFM:REP 32->57|PF01381|0.00048|42.3|26/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 32->88|1lliA|6e-04|23.1|52/89|a.35.1.2| OP:NHOMO 35 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------1--1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------1---111---------1-1--------------------------11------------------------------1-1------1--------------1---------1111-1-----------1----------------------11----------------111--1----1------------------------------------1------1------------------------1-------------------------------------------------------------------------------------------------------------------------------------1--------1--------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-16,52-65| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccHHHHccHHHHHHHHHHHHHHHccc //