[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08171.1
DDBJ      :             hydrogenase nickel insertion protein HypA
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  165/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->115 3a43B PDBj 5e-10 25.4 %
:RPS:PDB   3->115 3a44D PDBj 6e-32 29.2 %
:RPS:PFM   1->112 PF01155 * HypA 6e-19 43.8 %
:HMM:PFM   1->112 PF01155 * HypA 6.7e-32 37.5 112/113  
:BLT:SWISS 1->115 HYPA_POLNA 1e-45 70.4 %
:PROS 34->76|PS01249|HYPA

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08171.1 GT:GENE ABF08171.1 GT:PRODUCT hydrogenase nickel insertion protein HypA GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1405890..1406237) GB:FROM 1405890 GB:TO 1406237 GB:DIRECTION - GB:PRODUCT hydrogenase nickel insertion protein HypA GB:PROTEIN_ID ABF08171.1 GB:DB_XREF GI:93354082 InterPro:IPR000688 LENGTH 115 SQ:AASEQ MHEASLAGGVLQLVEDTARREGFARLLELRLEAGQLAGVDVRALRFALESIAPGTLMAGARIEIEEPPGQAWCLSCSQTVAIAQRGDACPACGGYQLQPTGGMELRIIDMKVSDD GT:EXON 1|1-115:0| BL:SWS:NREP 1 BL:SWS:REP 1->115|HYPA_POLNA|1e-45|70.4|115/115| PROS 34->76|PS01249|HYPA|PDOC00962| BL:PDB:NREP 1 BL:PDB:REP 2->115|3a43B|5e-10|25.4|114/117| RP:PDB:NREP 1 RP:PDB:REP 3->115|3a44D|6e-32|29.2|113/127| RP:PFM:NREP 1 RP:PFM:REP 1->112|PF01155|6e-19|43.8|112/113|HypA| HM:PFM:NREP 1 HM:PFM:REP 1->112|PF01155|6.7e-32|37.5|112/113|HypA| GO:PFM:NREP 2 GO:PFM GO:0006464|"GO:protein modification process"|PF01155|IPR000688| GO:PFM GO:0016151|"GO:nickel ion binding"|PF01155|IPR000688| OP:NHOMO 247 OP:NHOMOORG 169 OP:PATTERN --------------------------------1-11-----------------1-------------- 1------------------------1-------111-111--11---------------------111------------1------------1-------1-----------------------11--1--1-11-1111-----111-11---11-------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------111----------------1----------11212---121-1------------------------------------11-----11111-----------1----1-2------------------------------------------------------1-------11--32-----11----1-1----1---------------1-11-----1--2--111-2111111-1------11----------------------1--2211--------------------------------1--------2-1111-2222222222-2222222222222222222-------13333333333323233-2122222--2--------------------1111--1--111111-------------------1----------------------------------------------------------------------------------------------------------------11- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 99.1 SQ:SECSTR #cccHHHHHHHHHHHHHHHTTTcccccEEEEEEETTccccHHHHHHHHHHHHTTcTTTTcEEEEEEEccEEEcTTTcHHccTTGGGccccccccccccccccccccccccccccc DISOP:02AL 115-116| PSIPRED ccHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEcccccccHHHHHHHHHHHHccccccccEEEEEEcccEEEEcccccEEEcccccccccccccccEEEccccEEEEEEEEEEcc //