[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08179.1
DDBJ      :             putative plasmid maintenance system antidote protein, XRE family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:127 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   39->112 3cecA PDBj 7e-13 26.0 %
:RPS:SCOP  57->117 2icpA1  a.35.1.3 * 3e-04 27.9 %
:HMM:SCOP  35->103 2a6cA1 a.35.1.13 * 1.2e-09 27.9 %
:HMM:PFM   52->98 PF01381 * HTH_3 2.4e-09 31.9 47/55  
:HMM:PFM   18->68 PF05407 * Peptidase_C27 2.5e-05 43.8 48/166  
:BLT:SWISS 72->108 VAPI_DICNO 2e-05 48.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08179.1 GT:GENE ABF08179.1 GT:PRODUCT putative plasmid maintenance system antidote protein, XRE family GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1410478..1410861) GB:FROM 1410478 GB:TO 1410861 GB:DIRECTION - GB:PRODUCT putative plasmid maintenance system antidote protein, XRE family GB:PROTEIN_ID ABF08179.1 GB:DB_XREF GI:93354090 InterPro:IPR001387 LENGTH 127 SQ:AASEQ MIKASLSFCFFIMTRIGPRSSHPAAPVLPPVGVPLRVPTHPGRLLARTCLLPLALNQSEAARLLGLSRRRLHELVHGQRAMSPDTAIRCARQFGIDAGFWLAQQAAWDSFHAWKRLSSGSATSPFPR GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 72->108|VAPI_DICNO|2e-05|48.6|37/108| SEG 23->38|paapvlppvgvplrvp| SEG 43->55|rllartcllplal| SEG 62->71|rllglsrrrl| RP:PDB:NREP 1 RP:PDB:REP 39->112|3cecA|7e-13|26.0|73/90| HM:PFM:NREP 2 HM:PFM:REP 52->98|PF01381|2.4e-09|31.9|47/55|HTH_3| HM:PFM:REP 18->68|PF05407|2.5e-05|43.8|48/166|Peptidase_C27| RP:SCP:NREP 1 RP:SCP:REP 57->117|2icpA1|3e-04|27.9|61/87|a.35.1.3| HM:SCP:REP 35->103|2a6cA1|1.2e-09|27.9|68/0|a.35.1.13|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 73 STR:RPRED 57.5 SQ:SECSTR ######################################ccHHHHHHHHHHHHTc#cHHHHHHHHTccHHHHHHHHTTcccccHHHHHHHHHHHTccHHHHHHHHHHHHHHHH############### DISOP:02AL 1-3,121-123,126-128| PSIPRED cccHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccc //