[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08184.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:133 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   50->65 PF00401 * ATP-synt_DE 0.00069 43.8 16/48  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08184.1 GT:GENE ABF08184.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1415555..1415956 GB:FROM 1415555 GB:TO 1415956 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF08184.1 GB:DB_XREF GI:93354095 LENGTH 133 SQ:AASEQ MLNSVGRWNNRKLPMPASDSDLLAAAAHMHVLLRRKTGRVTDTEWMATNAEYARAMIEFAREKARSEQIEELLPLADRVEGLLASRTPPARPVWTGPRSQTPAPPAPASGPAEEGPLSSAQAALASRYIGRLR GT:EXON 1|1-133:0| SEG 17->33|asdsdllaaaahmhvll| SEG 102->116|pappapasgpaeegp| HM:PFM:NREP 1 HM:PFM:REP 50->65|PF00401|0.00069|43.8|16/48|ATP-synt_DE| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,5-5,97-118| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcc //