[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08193.1
DDBJ      :             Alcohol dehydrogenase GroES-like protein
Swiss-Prot:             

Homologs  Archaea  46/68 : Bacteria  707/915 : Eukaryota  161/199 : Viruses  0/175   --->[See Alignment]
b.35.1c.2.1c.30.1d.104.1
:353 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->277 2dphA PDBj 7e-28 33.2 %
:RPS:PDB   1->352 2b83A PDBj 3e-54 22.6 %
:RPS:SCOP  1->181 1bxzA1  b.35.1.2 * 1e-31 23.7 %
:RPS:SCOP  168->273 1a9xA3  c.30.1.1 * 3e-11 15.2 %
:RPS:SCOP  277->338 1j5wA  d.104.1.1 * 3e-04 38.9 %
:HMM:SCOP  1->198 1kolA1 b.35.1.2 * 3.5e-48 40.3 %
:HMM:SCOP  146->318 1d1tA2 c.2.1.1 * 1.5e-39 30.8 %
:RPS:PFM   27->134 PF08240 * ADH_N 3e-13 46.5 %
:RPS:PFM   186->293 PF00107 * ADH_zinc_N 4e-12 33.6 %
:HMM:PFM   26->136 PF08240 * ADH_N 4.8e-29 40.8 103/109  
:HMM:PFM   184->313 PF00107 * ADH_zinc_N 2.7e-24 28.1 128/130  
:BLT:SWISS 1->353 YBDR_ECOLI 1e-54 34.3 %
:PROS 61->75|PS00059|ADH_ZINC

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08193.1 GT:GENE ABF08193.1 GT:PRODUCT Alcohol dehydrogenase GroES-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1424194..1425255) GB:FROM 1424194 GB:TO 1425255 GB:DIRECTION - GB:PRODUCT Alcohol dehydrogenase GroES-like protein GB:PROTEIN_ID ABF08193.1 GB:DB_XREF GI:93354104 InterPro:IPR002328 InterPro:IPR013149 InterPro:IPR013154 LENGTH 353 SQ:AASEQ MKAAVYYGPQDIRCTDIPDPVIRSDHEMLVKVTATSICGSDLHLYRGALDGIMEKGKSQTGHELIGEVVEVGKSVGRFKQGDRVSMGYSVSCGHCYMCEVGQTAHCETTKNAVYGFGIPFGSINGTHAEALIVPHADGHAMNVPKGIPDEAAVTLSCNLPSAIIANRLADIQVGENVALVGCGPTGMMTLDIALHRGPGRVVVLDKVAHRLDVVRKKGGVAIDANQEDWKEKALAETGGRGFDKVIEVVGYPETLQMCLDLVRPGGTVAAIGVFCDSTFNLNLADVFLRNISLHMNGFANAQPYMWEALRLMERGVINPQEYFSHAFELADVDKAFSVFHQKSDSAMKVLIRP GT:EXON 1|1-353:0| BL:SWS:NREP 1 BL:SWS:REP 1->353|YBDR_ECOLI|1e-54|34.3|350/412| PROS 61->75|PS00059|ADH_ZINC|PDOC00058| BL:PDB:NREP 1 BL:PDB:REP 2->277|2dphA|7e-28|33.2|271/398| RP:PDB:NREP 1 RP:PDB:REP 1->352|2b83A|3e-54|22.6|345/351| RP:PFM:NREP 2 RP:PFM:REP 27->134|PF08240|3e-13|46.5|99/108|ADH_N| RP:PFM:REP 186->293|PF00107|4e-12|33.6|107/128|ADH_zinc_N| HM:PFM:NREP 2 HM:PFM:REP 26->136|PF08240|4.8e-29|40.8|103/109|ADH_N| HM:PFM:REP 184->313|PF00107|2.7e-24|28.1|128/130|ADH_zinc_N| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08240|IPR013154| GO:PFM GO:0008270|"GO:zinc ion binding"|PF00107|IPR013149| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00107|IPR013149| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00107|IPR013149| RP:SCP:NREP 3 RP:SCP:REP 1->181|1bxzA1|1e-31|23.7|173/178|b.35.1.2| RP:SCP:REP 168->273|1a9xA3|3e-11|15.2|105/127|c.30.1.1| RP:SCP:REP 277->338|1j5wA|3e-04|38.9|54/276|d.104.1.1| HM:SCP:REP 1->198|1kolA1|3.5e-48|40.3|191/0|b.35.1.2|1/1|GroES-like| HM:SCP:REP 146->318|1d1tA2|1.5e-39|30.8|172/0|c.2.1.1|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 4279 OP:NHOMOORG 914 OP:PATTERN 221-1-2888898AA61432-3--91122361-1----------31--1-331-1112111331--36 66D14315446-1158755-5D118K444446EFGGCGKF274AE5941422ACE645113475A3LFCA421111311--1B11--11131-1-----2-3-3-71523--------------1-1----1----2663211128533711------------124A8911-----------44333541717333333452443334B55556333431282222222234233333333433334334451-5--3-8--133441-3123373233231222311333323334342222222221222322111222232-13221222332274111-1---21-111--112141211233231-35375225-----6496A3-33445322112121117-63336645267-DCC6B9CBBABF45-523364356525222222225553--11------------------------------19532-2213C9999D88687BB9CAAAA168B84965--118242434342551-2-2-13-21211211133112111--1--11----344-1122133566B332----111111---1----------11222143419522111122332212141122---21--------3564234A77BABBBAA-7AAA9AA9AB7A9AAAAA67863543297B5A8C99CB69659754455471-344444444444---3111114333213981113-2-111--23-22324-412-6164662834456553355111212111-1111111-11211133544444432111--14332223--------1--------31--1-------21-----1311123333142 ------4------25HLNIGHSDSORJ8867677559867665545CC8EGIUQFIDA766734C17144454356758724443663-DNDL8C5KBD678A639-323E-32------1---2129-3B2-61111--4-24222---11-1-B315573-371364783521224-7--134A9CHKFD23IC581 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 353 STR:RPRED 100.0 SQ:SECSTR cEEEEEEETTEEEEEEccccccccTTcEEEEEEEEcccHHHHHHHHTcHcTTcccccEEccccEEEEEEEEcTTcccccTTcEEEEcccccccccHHHHTTcGGGTTcTTTTcccTTTccccccccccccEEEccHHHHcEEccTTccHHHHHTTTTHHHHHHHHHHHTTccTTccEEEEcccHHHHHHHHHHHTTTcccEEEEcccHHHHHHHHHHTcEEEcGGGccHHHHHHHHTTTccEEEEEEccccTTHHHHHHHHEEEEEEEEEccccccccccTTTTGGGTcccEEEEcccccHHHHHHHHHHHHHTTcccGGGGEEEEEEGGGHHHHHHHHHHccTTccEEEEEc PSIPRED cEEEEEEccccEEEEEEcccccccccEEEEEEEEEEEccccEEEEccccccccccccEEcccccEEEEEEEcccccccccccEEEEcccccccccHHHHccccccccccccccccccccccccccccEEEEEEccHHcEEEEccccccHHHHHHHcccHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHcccEEEcccccHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHcEEEEEEEEccccHHHHHHHHHHHHccccccHHHEEEEEEHHHHHHHHHHHHcccccEEEEEEEc //